KEGG   Homo sapiens (human): 2913Help
Entry
2913              CDS       T01001                                 

Gene name
GRM3, GLUR3, GPRC1C, MGLUR3, mGlu3
Definition
(RefSeq) glutamate metabotropic receptor 3
  KO
K04605  metabotropic glutamate receptor 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa05030  Cocaine addiction
Drug target
Pomaglumetad methionil (DG02201): D09949 D10896
Talaglumetad hydrochloride: D09008
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2913 (GRM3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2913 (GRM3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2913 (GRM3)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    2913 (GRM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2913 (GRM3)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic)
    2913 (GRM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2913
NCBI-ProteinID: NP_000831
OMIM: 601115
HGNC: 4595
Ensembl: ENSG00000198822
Vega: OTTHUMG00000022884
Pharos: Q14832(Tchem)
UniProt: Q14832 A4D1D0
Structure
PDB: 

Position
7q21.11-q21.12
AA seq 879 aa AA seqDB search
MKMLTRLQVLTLALFSKGFLLSLGDHNFLRREIKIEGDLVLGGLFPINEKGTGTEECGRI
NEDRGIQRLEAMLFAIDEINKDDYLLPGVKLGVHILDTCSRDTYALEQSLEFVRASLTKV
DEAEYMCPDGSYAIQENIPLLIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSD
KSRYDYFARTVPPDFYQAKAMAEILRFFNWTYVSTVASEGDYGETGIEAFEQEARLRNIC
IATAEKVGRSNIRKSYDSVIRELLQKPNARVVVLFMRSDDSRELIAAASRANASFTWVAS
DGWGAQESIIKGSEHVAYGAITLELASQPVRQFDRYFQSLNPYNNHRNPWFRDFWEQKFQ
CSLQNKRNHRRVCDKHLAIDSSNYEQESKIMFVVNAVYAMAHALHKMQRTLCPNTTKLCD
AMKILDGKKLYKDYLLKINFTAPFNPNKDADSIVKFDTFGDGMGRYNVFNFQNVGGKYSY
LKVGHWAETLSLDVNSIHWSRNSVPTSQCSDPCAPNEMKNMQPGDVCCWICIPCEPYEYL
ADEFTCMDCGSGQWPTADLTGCYDLPEDYIRWEDAWAIGPVTIACLGFMCTCMVVTVFIK
HNNTPLVKASGRELCYILLFGVGLSYCMTFFFIAKPSPVICALRRLGLGSSFAICYSALL
TKTNCIARIFDGVKNGAQRPKFISPSSQVFICLGLILVQIVMVSVWLILEAPGTRRYTLA
EKRETVILKCNVKDSSMLISLTYDVILVILCTVYAFKTRKCPENFNEAKFIGFTMYTTCI
IWLAFLPIFYVTSSDYRVQTTTMCISVSLSGFVVLGCLFAPKVHIILFQPQKNVVTHRLH
LNRFSVSGTGTTYSQSSASTYVPTVCNGREVLDSTTSSL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgttgacaagactgcaagttcttaccttagctttgttttcaaagggattttta
ctctctttaggggaccataactttctaaggagagagattaaaatagaaggtgaccttgtt
ttagggggcctgtttcctattaacgaaaaaggcactggaactgaagaatgtgggcgaatc
aatgaagaccgagggattcaacgcctggaagccatgttgtttgctattgatgaaatcaac
aaagatgattacttgctaccaggagtgaagttgggtgttcacattttggatacatgttca
agggatacctatgcattggagcaatcactggagtttgtcagggcatctttgacaaaagtg
gatgaagctgagtatatgtgtcctgatggatcctatgccattcaagaaaacatcccactt
ctcattgcaggggtcattggtggctcttatagcagtgtttccatacaggtggcaaacctg
ctgcggctcttccagatccctcagatcagctacgcatccaccagcgccaaactcagtgat
aagtcgcgctatgattactttgccaggaccgtgccccccgacttctaccaggccaaagcc
atggctgagatcttgcgcttcttcaactggacctacgtgtccacagtagcctccgagggt
gattacggggagacagggatcgaggccttcgagcaggaagcccgcctgcgcaacatctgc
atcgctacggcggagaaggtgggccgctccaacatccgcaagtcctacgacagcgtgatc
cgagaactgttgcagaagcccaacgcgcgcgtcgtggtcctcttcatgcgcagcgacgac
tcgcgggagctcattgcagccgccagccgcgccaatgcctccttcacctgggtggccagc
gacggctggggcgcgcaggagagcatcatcaagggcagcgagcatgtggcctacggcgcc
atcaccctggagctggcctcccagcctgtccgccagttcgaccgctacttccagagcctc
aacccctacaacaaccaccgcaacccctggttccgggacttctgggagcaaaagtttcag
tgcagcctccagaacaaacgcaaccacaggcgcgtctgcgacaagcacctggccatcgac
agcagcaactacgagcaagagtccaagatcatgtttgtggtgaacgcggtgtatgccatg
gcccacgctttgcacaaaatgcagcgcaccctctgtcccaacactaccaagctttgtgat
gctatgaagatcctggatgggaagaagttgtacaaggattacttgctgaaaatcaacttc
acggctccattcaacccaaataaagatgcagatagcatagtcaagtttgacacttttgga
gatggaatggggcgatacaacgtgttcaatttccaaaatgtaggtggaaagtattcctac
ttgaaagttggtcactgggcagaaaccttatcgctagatgtcaactctatccactggtcc
cggaactcagtccccacttcccagtgcagcgacccctgtgcccccaatgaaatgaagaat
atgcaaccaggggatgtctgctgctggatttgcatcccctgtgaaccctacgaatacctg
gctgatgagtttacctgtatggattgtgggtctggacagtggcccactgcagacctaact
ggatgctatgaccttcctgaggactacatcaggtgggaagacgcctgggccattggccca
gtcaccattgcctgtctgggttttatgtgtacatgcatggttgtaactgtttttatcaag
cacaacaacacacccttggtcaaagcatcgggccgagaactctgctacatcttattgttt
ggggttggcctgtcatactgcatgacattcttcttcattgccaagccatcaccagtcatc
tgtgcattgcgccgactcgggctggggagttccttcgctatctgttactcagccctgctg
accaagacaaactgcattgcccgcatcttcgatggggtcaagaatggcgctcagaggcca
aaattcatcagccccagttctcaggttttcatctgcctgggtctgatcctggtgcaaatt
gtgatggtgtctgtgtggctcatcctggaggccccaggcaccaggaggtatacccttgca
gagaagcgggaaacagtcatcctaaaatgcaatgtcaaagattccagcatgttgatctct
cttacctacgatgtgatcctggtgatcttatgcactgtgtacgccttcaaaacgcggaag
tgcccagaaaatttcaacgaagctaagttcataggttttaccatgtacaccacgtgcatc
atctggttggccttcctccctatattttatgtgacatcaagtgactacagagtgcagacg
acaaccatgtgcatctctgtcagcctgagtggctttgtggtcttgggctgtttgtttgca
cccaaggttcacatcatcctgtttcaaccccagaagaatgttgtcacacacagactgcac
ctcaacaggttcagtgtcagtggaactgggaccacatactctcagtcctctgcaagcacg
tatgtgccaacggtgtgcaatgggcgggaagtcctcgactccaccacctcatctctgtga

DBGET integrated database retrieval system