KEGG   Homo sapiens (human): 2914Help
Entry
2914              CDS       T01001                                 

Gene name
GRM4, GPRC1D, MGLUR4, mGlu4
Definition
(RefSeq) glutamate metabotropic receptor 4
  KO
K04607  metabotropic glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
hsa04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2914 (GRM4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2914 (GRM4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2914 (GRM4)
  09157 Sensory system
   04742 Taste transduction
    2914 (GRM4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2914 (GRM4)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2914 (GRM4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 Haem_degrading
Motif
Other DBs
NCBI-GeneID: 2914
NCBI-ProteinID: NP_000832
OMIM: 604100
HGNC: 4596
Ensembl: ENSG00000124493
Vega: OTTHUMG00000014538
Pharos: Q14833(Tchem)
UniProt: Q14833 A1L4F9
Position
6p21.31
AA seq 912 aa AA seqDB search
MPGKRGLGWWWARLPLCLLLSLYGPWMPSSLGKPKGHPHMNSIRIDGDITLGGLFPVHGR
GSEGKPCGELKKEKGIHRLEAMLFALDRINNDPDLLPNITLGARILDTCSRDTHALEQSL
TFVQALIEKDGTEVRCGSGGPPIITKPERVVGVIGASGSSVSIMVANILRLFKIPQISYA
STAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQ
KSREDGGVCIAQSVKIPREPKAGEFDKIIRRLLETSNARAVIIFANEDDIRRVLEAARRA
NQTGHFFWMGSDSWGSKIAPVLHLEEVAEGAVTILPKRMSVRGFDRYFSSRTLDNNRRNI
WFAEFWEDNFHCKLSRHALKKGSHVKKCTNRERIGQDSAYEQEGKVQFVIDAVYAMGHAL
HAMHRDLCPGRVGLCPRMDPVDGTQLLKYIRNVNFSGIAGNPVTFNENGDAPGRYDIYQY
QLRNDSAEYKVIGSWTDHLHLRIERMHWPGSGQQLPRSICSLPCQPGERKKTVKGMPCCW
HCEPCTGYQYQVDRYTCKTCPYDMRPTENRTGCRPIPIIKLEWGSPWAVLPLFLAVVGIA
ATLFVVITFVRYNDTPIVKASGRELSYVLLAGIFLCYATTFLMIAEPDLGTCSLRRIFLG
LGMSISYAALLTKTNRIYRIFEQGKRSVSAPRFISPASQLAITFSLISLQLLGICVWFVV
DPSHSVVDFQDQRTLDPRFARGVLKCDISDLSLICLLGYSMLLMVTCTVYAIKTRGVPET
FNEAKPIGFTMYTTCIVWLAFIPIFFGTSQSADKLYIQTTTLTVSVSLSASVSLGMLYMP
KVYIILFHPEQNVPKRKRSLKAVVTAATMSNKFTQKGNFRPNGEAKSELCENLEAPALAT
KQTYVTYTNHAI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagagaggcttgggctggtggtgggcccggctgcccctttgcctgctcctc
agcctttacggcccctggatgccttcctccctgggaaagcccaaaggccaccctcacatg
aattccatccgcatagatggggacatcacactgggaggcctgttcccggtgcatggccgg
ggctcagagggcaagccctgtggagaacttaagaaggaaaagggcatccaccggctggag
gccatgctgttcgccctggatcgcatcaacaacgacccggacctgctgcctaacatcacg
ctgggcgcccgcattctggacacctgctccagggacacccatgccctcgagcagtcgctg
acctttgtgcaggcgctcatcgagaaggatggcacagaggtccgctgtggcagtggcggc
ccacccatcatcaccaagcctgaacgtgtggtgggtgtcatcggtgcttcagggagctcg
gtctccatcatggtggccaacatccttcgcctcttcaagataccccagatcagctacgcc
tccacagcgccagacctgagtgacaacagccgctacgacttcttctcccgcgtggtgccc
tcggacacgtaccaggcccaggccatggtggacatcgtccgtgccctcaagtggaactat
gtgtccacagtggcctcggagggcagctatggtgagagcggtgtggaggccttcatccag
aagtcccgtgaggacgggggcgtgtgcatcgcccagtcggtgaagataccacgggagccc
aaggcaggcgagttcgacaagatcatccgccgcctcctggagacttcgaacgccagggca
gtcatcatctttgccaacgaggatgacatcaggcgtgtgctggaggcagcacgaagggcc
aaccagacaggccatttcttctggatgggctctgacagctggggctccaagattgcacct
gtgctgcacctggaggaggtggctgagggtgctgtcacgatcctccccaagaggatgtcc
gtacgaggcttcgaccgctacttctccagccgcacgctggacaacaaccggcgcaacatc
tggtttgccgagttctgggaggacaacttccactgcaagctgagccgccacgccctcaag
aagggcagccacgtcaagaagtgcaccaaccgtgagcgaattgggcaggattcagcttat
gagcaggaggggaaggtgcagtttgtgatcgatgccgtgtacgccatgggccacgcgctg
cacgccatgcaccgtgacctgtgtcccggccgcgtggggctctgcccgcgcatggaccct
gtagatggcacccagctgcttaagtacatccgaaacgtcaacttctcaggcatcgcaggg
aaccctgtgaccttcaatgagaatggagatgcgcctgggcgctatgacatctaccaatac
cagctgcgcaacgattctgccgagtacaaggtcattggctcctggactgaccacctgcac
cttagaatagagcggatgcactggccggggagcgggcagcagctgccccgctccatctgc
agcctgccctgccaaccgggtgagcggaagaagacagtgaagggcatgccttgctgctgg
cactgcgagccttgcacagggtaccagtaccaggtggaccgctacacctgtaagacgtgt
ccctatgacatgcggcccacagagaaccgcacgggctgccggcccatccccatcatcaag
cttgagtggggctcgccctgggccgtgctgcccctcttcctggccgtggtgggcatcgct
gccacgttgttcgtggtgatcacctttgtgcgctacaacgacacgcccatcgtcaaggcc
tcgggccgtgaactgagctacgtgctgctggcaggcatcttcctgtgctatgccaccacc
ttcctcatgatcgctgagcccgaccttggcacctgctcgctgcgccgaatcttcctggga
ctagggatgagcatcagctatgcagccctgctcaccaagaccaaccgcatctaccgcatc
ttcgagcagggcaagcgctcggtcagtgccccacgcttcatcagccccgcctcacagctg
gccatcaccttcagcctcatctcgctgcagctgctgggcatctgtgtgtggtttgtggtg
gacccctcccactcggtggtggacttccaggaccagcggacactcgacccccgcttcgcc
aggggtgtgctcaagtgtgacatctcggacctgtcgctcatctgcctgctgggctacagc
atgctgctcatggtcacgtgcaccgtgtatgccatcaagacacgcggcgtgcccgagacc
ttcaatgaggccaagcccattggcttcaccatgtacaccacttgcatcgtctggctggcc
ttcatccccatcttctttggcacctcgcagtcggccgacaagctgtacatccagacgacg
acgctgacggtctcggtgagtctgagcgcctcggtgtccctgggaatgctctacatgccc
aaagtctacatcatcctcttccacccggagcagaacgtgcccaagcgcaagcgcagcctc
aaagccgtcgttacggcggccaccatgtccaacaagttcacgcagaagggcaacttccgg
cccaacggagaggccaagtctgagctctgcgagaaccttgaggccccagcgctggccacc
aaacagacttacgtcacttacaccaaccatgcaatctag

DBGET integrated database retrieval system