KEGG   Homo sapiens (human): 2915Help
Entry
2915              CDS       T01001                                 

Gene name
GRM5, GPRC1E, MGLUR5, PPP1R86, mGlu5
Definition
(RefSeq) glutamate metabotropic receptor 5
  KO
K04604  metabotropic glutamate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa05010  Alzheimer disease
hsa05016  Huntington disease
Network
nt06410  Calcium signaling
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00984  mGluR5-Ca2+ -apoptotic pathway
N00985  Mutation-caused aberrant Htt to mGluR5-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
Drug target
Fenobam: D04155
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2915 (GRM5)
   04072 Phospholipase D signaling pathway
    2915 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2915 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2915 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2915 (GRM5)
   04720 Long-term potentiation
    2915 (GRM5)
   04723 Retrograde endocannabinoid signaling
    2915 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    2915 (GRM5)
   05016 Huntington disease
    2915 (GRM5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2915 (GRM5)
G protein-coupled receptors [BR:hsa04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   2915 (GRM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G DUF5438
Motif
Other DBs
NCBI-GeneID: 2915
NCBI-ProteinID: NP_001137303
OMIM: 604102
HGNC: 4597
Ensembl: ENSG00000168959
Vega: OTTHUMG00000134306
Pharos: P41594(Tchem)
UniProt: P41594
Structure
PDB: 

Position
11q14.2-q14.3
AA seq 1212 aa AA seqDB search
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGAGGSAGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPS
PISTLSHRAGSASRTDDDVPSLHSEPVARSSSSQGSLMEQISSVVTRFTANISELNSMML
STAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAAGDAA
RESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTL
IIRDYTQSSSSL
NT seq 3639 nt NT seq  +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcggtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggatcaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggactcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagaaggcttggtacgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaggcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaaaatctacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaagctccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctatgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatacgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtgtgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgacttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttactgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcgaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggtcagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagttccaatggaaaatccgtcacgtgggcccagaat
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgtggc
ctgggcgctggcgctggcgcaggcgggagcgctgggggcgtgggggccacgggcggtgcg
ggctgcgcaggcgccggcccaggcgggcccgagtccccagacgccggccccaaggcgctg
tatgatgtggccgaggctgaggagcacttcccggcgcccgcgcggccgcgctcaccgtcg
cccatcagcacgctgagccaccgcgcgggctcggccagccgcacggacgacgatgtgccg
tcgctgcactcggagcctgtggcgcgcagcagctcctcgcagggctccctcatggagcag
atcagcagtgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctg
tccaccgcggcccccagccccggcgtcggcgccccgctctgctcgtcctacctgatcccc
aaagagatccagttgcccacgaccatgacgacctttgccgaaatccagcctctgccggcc
atcgaagtcacgggaggcgcgcagcccgcggcaggggcgcaggcggctggggacgcggcc
cgggagagccccgcggccggtcccgaggctgcggccgccaagccagacctggaggagctg
gtggctctcaccccgccgtcccccttcagagactcggtggactcggggagcacaaccccc
aactcgccagtgtccgagtcggccctctgtatcccgtcgtctcccaaatatgacactctt
atcataagagattacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system