KEGG   Homo sapiens (human): 2917Help
Entry
2917              CDS       T01001                                 

Gene name
GRM7, GLUR7, GPRC1G, MGLU7, MGLUR7, PPP1R87
Definition
(RefSeq) glutamate metabotropic receptor 7
  KO
K04608  metabotropic glutamate receptor 6/7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04724  Glutamatergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    2917 (GRM7)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2917 (GRM7)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    2917 (GRM7)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     2917 (GRM7)
G protein-coupled receptors [BR:hsa04030]
 Class C. Metabotropic glutamate receptor family
  Biogenic amine
   Glutamate (metabotropic) [OT]
    2917 (GRM7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor 7tm_3 NCD3G Peripla_BP_6 DUF2318
Motif
Other DBs
NCBI-GeneID: 2917
NCBI-ProteinID: NP_000835
OMIM: 604101
HGNC: 4599
Ensembl: ENSG00000196277
Vega: OTTHUMG00000125549
Pharos: Q14831(Tbio)
UniProt: Q14831 B2R693 Q59G95
Structure
PDB: 

Position
3p26.1
AA seq 915 aa AA seqDB search
MVQLRKLLRVLTLMKFPCCVLEVLLCALAAAARGQEMYAPHSIRIEGDVTLGGLFPVHAK
GPSGVPCGDIKRENGIHRLEAMLYALDQINSDPNLLPNVTLGARILDTCSRDTYALEQSL
TFVQALIQKDTSDVRCTNGEPPVFVKPEKVVGVIGASGSSVSIMVANILRLFQIPQISYA
STAPELSDDRRYDFFSRVVPPDSFQAQAMVDIVKALGWNYVSTLASEGSYGEKGVESFTQ
ISKEAGGLCIAQSVRIPQERKDRTIDFDRIIKQLLDTPNSRAVVIFANDEDIKQILAAAK
RADQVGHFLWVGSDSWGSKINPLHQHEDIAEGAITIQPKRATVEGFDAYFTSRTLENNRR
NVWFAEYWEENFNCKLTISGSKKEDTDRKCTGQERIGKDSNYEQEGKVQFVIDAVYAMAH
ALHHMNKDLCADYRGVCPEMEQAGGKKLLKYIRNVNFNGSAGTPVMFNKNGDAPGRYDIF
QYQTTNTSNPGYRLIGQWTDELQLNIEDMQWGKGVREIPASVCTLPCKPGQRKKTQKGTP
CCWTCEPCDGYQYQFDEMTCQHCPYDQRPNENRTGCQDIPIIKLEWHSPWAVIPVFLAML
GIIATIFVMATFIRYNDTPIVRASGRELSYVLLTGIFLCYIITFLMIAKPDVAVCSFRRV
FLGLGMCISYAALLTKTNRIYRIFEQGKKSVTAPRLISPTSQLAITSSLISVQLLGVFIW
FGVDPPNIIIDYDEHKTMNPEQARGVLKCDITDLQIICSLGYSILLMVTCTVYAIKTRGV
PENFNEAKPIGFTMYTTCIVWLAFIPIFFGTAQSAEKLYIQTTTLTISMNLSASVALGML
YMPKVYIIIFHPELNVQKRKRSFKAVVTAATMSSRLSHKPSDRPNGEAKTELCENVDPNS
PAAKKKYVSYNNLVI
NT seq 2748 nt NT seq  +upstreamnt  +downstreamnt
atggtccagctgaggaagctgctccgcgtcctgactttgatgaagttcccctgctgcgtg
ctggaggtgctcctgtgcgcgctggcggcggcggcgcgcggccaggagatgtacgccccg
cactcaatccggatcgagggggacgtcaccctcggggggctgttccccgtgcacgccaag
ggtcccagcggagtgccctgcggcgacatcaagagggaaaacgggatccacaggctggaa
gcgatgctctacgccctggaccagatcaacagtgatcccaacctactgcccaacgtgacg
ctgggcgcgcggatcctggacacttgttccagggacacttacgcgctcgaacagtcgctt
actttcgtccaggcgctcatccagaaggacacctccgacgtgcgctgcaccaacggcgaa
ccgccggttttcgtcaagccggagaaagtagttggagtgattggggcttcggggagttcg
gtctccatcatggtagccaacatcctgaggctcttccagatcccccagattagttatgca
tcaacggcacccgagctaagtgatgaccggcgctatgacttcttctctcgcgtggtgcca
cccgattccttccaagcccaggccatggtagacattgtaaaggccctaggctggaattat
gtgtctaccctcgcatcggaaggaagttatggagagaaaggtgtggagtccttcacgcag
atttccaaagaggcaggtggactctgcattgcccagtccgtgagaatcccccaggaacgc
aaagacaggaccattgactttgatagaattatcaaacagctcctggacacccccaactcc
agggccgtcgtgatttttgccaacgatgaggatataaagcagatccttgcagcagccaaa
agagctgaccaagttggccattttctttgggtgggatcagacagctggggatccaaaata
aacccactgcaccagcatgaagatatcgcagaaggggccatcaccattcagcccaagcga
gccacggtggaagggtttgatgcctactttacgtcccgtacacttgaaaacaacagaaga
aatgtatggtttgccgaatactgggaggaaaacttcaactgcaagttgacgattagtggg
tcaaaaaaagaagacacagatcgcaaatgcacaggacaggagagaattggaaaagattcc
aactatgagcaggagggtaaagtccagttcgtgattgacgcagtctatgctatggctcac
gcccttcaccacatgaacaaggatctctgtgctgactaccggggtgtctgcccagagatg
gagcaagctggaggcaagaagttgctgaagtatatacgcaatgttaatttcaatggtagt
gctggcactccagtgatgtttaacaagaacggggatgcacctgggcgttatgacatcttt
cagtaccagaccacaaacaccagcaacccgggttaccgtctgatcgggcagtggacagac
gaacttcagctcaatatagaagacatgcagtggggtaaaggagtccgagagatacccgcc
tcagtgtgcacactaccatgtaagccaggacagagaaagaagacacagaaaggaactcct
tgctgttggacctgtgagccttgcgatggttaccagtaccagtttgatgagatgacatgc
cagcattgcccctatgaccagaggcccaatgaaaatcgaaccggatgccaggatattccc
atcatcaaactggagtggcactccccctgggctgtgattcctgtcttcctggcaatgttg
gggatcattgccaccatctttgtcatggccactttcatccgctacaatgacacgcccatt
gtccgggcatctgggcgggaactcagctatgttcttttgacgggcatctttctttgctac
atcatcactttcctgatgattgccaaaccagatgtggcagtgtgttctttccggcgagtt
ttcttgggcttgggtatgtgcatcagttatgcagccctcttgacgaaaacaaatcggatt
tatcgcatatttgagcagggcaagaaatcagtaacagctcccagactcataagcccaaca
tcacaactggcaatcacttccagtttaatatcagttcagcttctaggggtgttcatttgg
tttggtgttgatccacccaacatcatcatagactatgatgaacacaagacaatgaaccct
gagcaagccagaggggttctcaagtgtgacattacagatctccaaatcatttgctccttg
ggatatagcattcttctcatggtcacatgtactgtgtatgccatcaagactcggggtgta
cccgagaattttaacgaagccaagcccattggattcactatgtacacgacatgtatagta
tggcttgccttcattccaattttttttggcaccgctcaatcagcggaaaagctctacata
caaactaccacgcttacaatctccatgaacctaagtgcatcagtggcgctggggatgcta
tacatgccgaaagtgtacatcatcattttccaccctgaactcaatgtccagaaacggaag
cgaagcttcaaggcggtagtcacagcagccaccatgtcatcgaggctgtcacacaaaccc
agtgacagacccaacggtgaggcaaagaccgagctctgtgaaaacgtagacccaaacagc
cctgctgcaaaaaagaagtatgtcagttataataacctggttatctaa

DBGET integrated database retrieval system