KEGG   Homo sapiens (human): 2919Help
Entry
2919              CDS       T01001                                 

Gene name
CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Definition
(RefSeq) C-X-C motif chemokine ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    2919 (CXCL1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2919 (CXCL1)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    2919 (CXCL1)
   04657 IL-17 signaling pathway
    2919 (CXCL1)
   04062 Chemokine signaling pathway
    2919 (CXCL1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    2919 (CXCL1)
  Infectious diseases
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2919 (CXCL1)
   05132 Salmonella infection
    2919 (CXCL1)
   05134 Legionellosis
    2919 (CXCL1)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    2919 (CXCL1)
   05146 Amoebiasis
    2919 (CXCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2919 (CXCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 2919
NCBI-ProteinID: NP_001502
OMIM: 155730
HGNC: 4602
Ensembl: ENSG00000163739
Vega: OTTHUMG00000160866
Pharos: P09341(Tbio)
UniProt: P09341
Structure
PDB: 

Position
4q13.3
AA seq 107 aa AA seqDB search
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgctgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg
ctgctcctgctcctggtagccgctggccggcgcgcagcaggagcgtccgtggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg
aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcggaaagcttgcctcaatcctgcatcccccatagttaagaaaatcatcgaaaagatg
ctgaacagtgacaaatccaactga

DBGET integrated database retrieval system