KEGG   Homo sapiens (human): 2919Help
Entry
2919              CDS       T01001                                 

Gene name
CXCL1, FSP, GRO1, GROa, MGSA, MGSA-a, NAP-3, SCYB1
Definition
(RefSeq) C-X-C motif chemokine ligand 1
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    2919 (CXCL1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2919 (CXCL1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2919 (CXCL1)
   04657 IL-17 signaling pathway
    2919 (CXCL1)
   04062 Chemokine signaling pathway
    2919 (CXCL1)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    2919 (CXCL1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2919 (CXCL1)
   05132 Salmonella infection
    2919 (CXCL1)
   05134 Legionellosis
    2919 (CXCL1)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2919 (CXCL1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2919 (CXCL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2919 (CXCL1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2919 (CXCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 2919
NCBI-ProteinID: NP_001502
OMIM: 155730
HGNC: 4602
Ensembl: ENSG00000163739
Vega: OTTHUMG00000160866
Pharos: P09341(Tbio)
UniProt: P09341
Structure
PDB: 

Position
4q13.3
AA seq 107 aa AA seqDB search
MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSV
NVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgctgctctctccgccgcccccagcaatccccggctcctgcgagtggcactg
ctgctcctgctcctggtagccgctggccggcgcgcagcaggagcgtccgtggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcaccccaagaacatccaaagtgtg
aacgtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcggaaagcttgcctcaatcctgcatcccccatagttaagaaaatcatcgaaaagatg
ctgaacagtgacaaatccaactga

DBGET integrated database retrieval system