KEGG   Homo sapiens (human): 2920Help
Entry
2920              CDS       T01001                                 

Gene name
CXCL2, CINC-2a, GRO2, GROb, MGSA-b, MIP-2a, MIP2, MIP2A, SCYB2
Definition
(RefSeq) C-X-C motif chemokine ligand 2
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    2920 (CXCL2)
   04668 TNF signaling pathway
    2920 (CXCL2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2920 (CXCL2)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    2920 (CXCL2)
   04657 IL-17 signaling pathway
    2920 (CXCL2)
   04062 Chemokine signaling pathway
    2920 (CXCL2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    2920 (CXCL2)
   05134 Legionellosis
    2920 (CXCL2)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    2920 (CXCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2920 (CXCL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL8
Motif
Other DBs
NCBI-GeneID: 2920
NCBI-ProteinID: NP_002080
OMIM: 139110
HGNC: 4603
Ensembl: ENSG00000081041
Vega: OTTHUMG00000160865
Pharos: P19875(Tbio)
UniProt: P19875 A0A024RDD9
Structure
PDB: 

Position
4q13.3
AA seq 107 aa AA seqDB search
MARATLSAAPSNPRLLRVALLLLLLVAASRRAAGAPLATELRCQCLQTLQGIHLKNIQSV
KVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgcccctggccactgaa
ctgcgctgccagtgcttgcagaccctgcagggaattcacctcaagaacatccaaagtgtg
aaggtgaagtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggcagaaagcttgtctcaaccccgcatcgcccatggttaagaaaatcatcgaaaagatg
ctgaaaaatggcaaatccaactga

DBGET integrated database retrieval system