KEGG   Homo sapiens (human): 2921
Entry
2921              CDS       T01001                                 
Symbol
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Name
(RefSeq) C-X-C motif chemokine ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06150  Cytokine-cytokine receptor interaction (viruses)
  Element
N01238  CXCL1/2/3/5/6/7/8 to CXCR2 signaling
N01239  CXCL2/3/7 to KSHV vGPCR signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2921 (CXCL3)
   04668 TNF signaling pathway
    2921 (CXCL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2921 (CXCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2921 (CXCL3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2921 (CXCL3)
   04657 IL-17 signaling pathway
    2921 (CXCL3)
   04062 Chemokine signaling pathway
    2921 (CXCL3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2921 (CXCL3)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2921 (CXCL3)
   05134 Legionellosis
    2921 (CXCL3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2921 (CXCL3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    2921 (CXCL3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    2921 (CXCL3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    2921 (CXCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2921 (CXCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2921 (CXCL3)
SSDB
Motif
Pfam: IL8 Lenti_VIF_2
Other DBs
NCBI-GeneID: 2921
NCBI-ProteinID: NP_002081
OMIM: 139111
HGNC: 4604
Ensembl: ENSG00000163734
Pharos: P19876(Tbio)
UniProt: P19876
Position
4:complement(74036589..74038689)
AA seq 107 aa
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system