KEGG   Homo sapiens (human): 2921
Entry
2921              CDS       T01001                                 

Gene name
CXCL3, CINC-2b, GRO3, GROg, MIP-2b, MIP2B, SCYB3
Definition
(RefSeq) C-X-C motif chemokine ligand 3
  KO
K05505  C-X-C motif chemokine 1/2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05134  Legionellosis
hsa05146  Amoebiasis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    2921 (CXCL3)
   04668 TNF signaling pathway
    2921 (CXCL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2921 (CXCL3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2921 (CXCL3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    2921 (CXCL3)
   04657 IL-17 signaling pathway
    2921 (CXCL3)
   04062 Chemokine signaling pathway
    2921 (CXCL3)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    2921 (CXCL3)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    2921 (CXCL3)
   05134 Legionellosis
    2921 (CXCL3)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    2921 (CXCL3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    2921 (CXCL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2921 (CXCL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   2921 (CXCL3)
SSDB
Motif
Pfam: IL8 Lenti_VIF_2
Other DBs
NCBI-GeneID: 2921
NCBI-ProteinID: NP_002081
OMIM: 139111
HGNC: 4604
Ensembl: ENSG00000163734
Vega: OTTHUMG00000160861
Pharos: P19876(Tbio)
UniProt: P19876
Position
4q13.3
AA seq 107 aa
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSV
NVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcccacgccacgctctccgccgcccccagcaatccccggctcctgcgggtggcgctg
ctgctcctgctcctggtggccgccagccggcgcgcagcaggagcgtccgtggtcactgaa
ctgcgctgccagtgcttgcagacactgcagggaattcacctcaagaacatccaaagtgtg
aatgtaaggtcccccggaccccactgcgcccaaaccgaagtcatagccacactcaagaat
gggaagaaagcttgtctcaaccccgcatcccccatggttcagaaaatcatcgaaaagata
ctgaacaaggggagcaccaactga

DBGET integrated database retrieval system