KEGG   Homo sapiens (human): 2925Help
Entry
2925              CDS       T01001                                 

Gene name
GRPR, BB2, BB2R
Definition
(RefSeq) gastrin releasing peptide receptor
  KO
K04169  gastrin-releasing peptide receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2925 (GRPR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2925 (GRPR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2925 (GRPR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bombesin
    2925 (GRPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 2925
NCBI-ProteinID: NP_005305
OMIM: 305670
HGNC: 4609
Ensembl: ENSG00000126010
Vega: OTTHUMG00000021189
Pharos: P30550(Tchem)
UniProt: P30550 X5D7H2
Position
Xp22.2
AA seq 384 aa AA seqDB search
MALNDCFLLNLEVDHFMHCNISSHSADLPVNDDWSHPGILYVIPAVYGVIILIGLIGNIT
LIKIFCTVKSMRNVPNLFISSLALGDLLLLITCAPVDASRYLADRWLFGRIGCKLIPFIQ
LTSVGVSVFTLTALSADRYKAIVRPMDIQASHALMKICLKAAFIWIISMLLAIPEAVFSD
LHPFHEESTNQTFISCAPYPHSNELHPKIHSMASFLVFYVIPLSIISVYYYFIAKNLIQS
AYNLPVEGNIHVKKQIESRKRLAKTVLVFVGLFAFCWLPNHVIYLYRSYHYSEVDTSMLH
FVTSICARLLAFTNSCVNPFALYLLSKSFRKQFNTQLLCCQPGLIIRSHSTGRSTTCMTS
LKSTNPSVATFSLINGNICHERYV
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggctctaaatgactgtttccttctgaacttggaggtggaccatttcatgcactgcaac
atctccagtcacagtgcggatctccccgtgaacgatgactggtcccacccggggatcctc
tatgtcatccctgcagtttatggggttatcattctgataggcctcattggcaacatcact
ttgatcaagatcttctgtacagtcaagtccatgcgaaacgttccaaacctgttcatttcc
agtctggctttgggagacctgctcctcctaataacgtgtgctccagtggatgccagcagg
tacctggctgacagatggctatttggcaggattggctgcaaactgatcccctttatacag
cttacctctgttggggtgtctgtcttcacactcacggcgctctcggcagacagatacaaa
gccattgtccggccaatggatatccaggcctctcatgccctgatgaagatctgcctcaaa
gccgcctttatctggatcatctccatgctgctggccattccagaggccgtgttttctgac
ctccatcccttccatgaggaaagcaccaaccagaccttcattagctgtgccccataccca
cactctaatgagcttcaccccaaaatccattctatggcttcctttctggtcttctacgtc
attccactgtcgatcatctctgtttactactacttcattgctaaaaatctgatccagagt
gcttacaatcttcccgtggaagggaatatacatgtcaagaagcagattgaatcccggaag
cgacttgccaagacagtgctggtgtttgtgggcctgttcgccttctgctggctccccaat
catgtcatctacctgtaccgctcctaccactactctgaggtggacacctccatgctccac
tttgtcaccagcatctgtgcccgcctcctggccttcaccaactcctgcgtgaaccccttt
gccctctacctgctgagcaagagtttcaggaaacagttcaacactcagctgctctgttgc
cagcctggcctgatcatccggtctcacagcactggaaggagtacaacctgcatgacctcc
ctcaagagtaccaacccctccgtggccacctttagcctcatcaatggaaacatctgtcac
gagcggtatgtctag

DBGET integrated database retrieval system