KEGG   Homo sapiens (human): 2928
Entry
2928              CDS       T01001                                 

Gene name
GSC2, GSCL
Definition
(RefSeq) goosecoid homeobox 2
  KO
K09325  homeobox protein goosecoid-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2928 (GSC2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Prd
    2928 (GSC2)
SSDB
Motif
Pfam: Homeodomain Homeobox_KN
Other DBs
NCBI-GeneID: 2928
NCBI-ProteinID: NP_005306
OMIM: 601845
HGNC: 4613
Ensembl: ENSG00000063515
Vega: OTTHUMG00000150122
Pharos: O15499(Tbio)
UniProt: O15499
Position
22q11.21
AA seq 205 aa
MAAAAGGAASRRGAGRPCPFSIEHILSSLPERSLPARAACPPQPAGRQSPAKPEEPGAPE
AAPCACCCCCGPRAAPCGPPEAAAGLGARLAWPLRLGPAVPLSLGAPAGGSGALPGAVGP
GSQRRTRRHRTIFSEEQLQALEALFVQNQYPDVSTRERLAGRIRLREERVEVWFKNRRAK
WRHQKRASASARLLPGVKKSPKGSC
NT seq 618 nt   +upstreamnt  +downstreamnt
atggcggcagcggctgggggcgcggcgagccgccggggtgccgggcggccctgccccttc
tccatcgagcacatcctctccagcctgcccgagcggagcctcccggcccgggccgcctgc
ccaccgcagcccgccggtcgccagagccccgcgaagccagaggagcccggggcgcccgag
gctgcgccctgcgcctgctgctgctgctgcggcccccgcgcggcgccctgcgggccccca
gaggcggccgccgggctgggcgctcgtctggcgtggccgctgaggctgggaccggcggtg
cccttgtctctgggtgcgccagccggaggttccggggcgctcccgggcgcggtcggcccg
ggttcgcagcggcgcacgaggcgccaccgcaccatcttcagcgaagagcagctgcaggcg
ctcgaggcgcttttcgtgcagaaccagtatcctgacgtgagtacgcgcgagcgcctggcc
ggccgcatccgccttcgcgaggagcgcgtggaggtctggttcaagaaccgccgggccaaa
tggcgacaccagaagcgcgcgtcggcttccgcgaggctcctgcccggcgtcaagaagtcc
ccgaaggggagctgctga

DBGET integrated database retrieval system