KEGG   Homo sapiens (human): 2931Help
Entry
2931              CDS       T01001                                 

Gene name
GSK3A
Definition
(RefSeq) glycogen synthase kinase 3 alpha
  KO
K08822  glycogen synthase kinase 3 alpha [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04728  Dopaminergic synapse
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2931 (GSK3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    2931 (GSK3A)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2931 (GSK3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2931 (GSK3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2931 (GSK3A)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   2931 (GSK3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 2931
NCBI-ProteinID: NP_063937
OMIM: 606784
HGNC: 4616
Ensembl: ENSG00000105723
Vega: OTTHUMG00000150722
Pharos: P49840(Tclin)
UniProt: P49840 A0A024R0L5
Position
19q13.2
AA seq 483 aa AA seqDB search
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagc
tcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcc
tccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtc
ggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggcccc
ggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtg
accacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacg
gacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagag
accagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagag
ctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctac
tccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgag
acagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctat
gtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtg
tgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaag
ctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatc
tgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatcc
atcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttc
cctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacc
cgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaa
gctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgc
tctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcac
agcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccc
cctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctc
atccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagct
ttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcact
aactcctcctga

DBGET integrated database retrieval system