KEGG   Homo sapiens (human): 2931Help
Entry
2931              CDS       T01001                                 

Gene name
GSK3A
Definition
(RefSeq) glycogen synthase kinase 3 alpha
  KO
K08822  glycogen synthase kinase 3 alpha [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04728  Dopaminergic synapse
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2931 (GSK3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    2931 (GSK3A)
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2931 (GSK3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2931 (GSK3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2931 (GSK3A)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   2931 (GSK3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo
Motif
Other DBs
NCBI-GeneID: 2931
NCBI-ProteinID: NP_063937
OMIM: 606784
HGNC: 4616
Ensembl: ENSG00000105723
Vega: OTTHUMG00000150722
Pharos: P49840(Tclin)
UniProt: P49840 A0A024R0L5
Position
19q13.2
AA seq 483 aa AA seqDB search
MSGGGPSGGGPGGSGRARTSSFAEPGGGGGGGGGGPGGSASGPGGTGGGKASVGAMGGGV
GASSSGGGPGGSGGGGSGGPGAGTSFPPPGVKLGRDSGKVTTVVATLGQGPERSQEVAYT
DIKVIGNGSFGVVYQARLAETRELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
SSGEKKDELYLNLVLEYVPETVYRVARHFTKAKLTIPILYVKVYMYQLFRSLAYIHSQGV
CHRDIKPQNLLVDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSS
IDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIK
AHPWTKVFKSRTPPEAIALCSSLLEYTPSSRLSPLEACAHSFFDELRCLGTQLPNNRPLP
PLFNFSAGELSIQPSLNAILIPPHLRSPAGTTTLTPSSQALTETPTSSDWQSTDATPTLT
NSS
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcgggccttcgggaggcggccctgggggctcgggcagggcgcggactagc
tcgttcgcggagcccggcggcggaggcggaggaggcggcggcggccccggaggctcggcc
tccggcccaggcggcaccggcggcggaaaggcatctgtcggggccatgggtgggggcgtc
ggggcctcgagctccgggggtggacccggcggcagcggcggaggaggcagcggaggcccc
ggcgcaggcactagcttcccgccgcccggggtgaagctgggccgtgacagcgggaaggtg
accacagtcgtagccactctaggccaaggcccagagcgctcccaagaagtggcttacacg
gacatcaaagtgattggcaatggctcatttggggtcgtgtaccaggcacggctggcagag
accagggaactagtcgccatcaagaaggttctccaggacaagaggttcaagaaccgagag
ctgcagatcatgcgtaagctggaccactgcaatattgtgaggctgagatactttttctac
tccagtggcgagaagaaagacgagctttacctaaatctggtgctggaatatgtgcccgag
acagtgtaccgggtggcccgccacttcaccaaggccaagttgaccatccctatcctctat
gtcaaggtgtacatgtaccagctcttccgcagcttggcctacatccactcccagggcgtg
tgtcaccgcgacatcaagccccagaacctgctggtggaccctgacactgctgtcctcaag
ctctgcgattttggcagtgcaaagcagttggtccgaggggagcccaatgtctcctacatc
tgttctcgctactaccgggccccagagctcatctttggagccactgattacacctcatcc
atcgatgtttggtcagctggctgtgtactggcagagctcctcttgggccagcccatcttc
cctggggacagtggggtggaccagctggtggagatcatcaaggtgctgggaacaccaacc
cgggaacaaatccgagagatgaaccccaactacacggagttcaagttccctcagattaaa
gctcacccctggacaaaggtgttcaaatctcgaacgccgccagaggccatcgcgctctgc
tctagcctgctggagtacaccccatcctcaaggctctccccactagaggcctgtgcgcac
agcttctttgatgaactgcgatgtctgggaacccagctgcctaacaaccgcccacttccc
cctctcttcaacttcagtgctggtgaactctccatccaaccgtctctcaacgccattctc
atccctcctcacttgaggtccccagcgggcactaccaccctcaccccgtcctcacaagct
ttaactgagactccgaccagctcagactggcagtcgaccgatgccacacctaccctcact
aactcctcctga

KEGG   Homo sapiens (human): 2932Help
Entry
2932              CDS       T01001                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase 3 beta
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04110  Cell cycle
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04728  Dopaminergic synapse
hsa04910  Insulin signaling pathway
hsa04916  Melanogenesis
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05160  Hepatitis C
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05215  Prostate cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00175  KSHV LANA to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    2932 (GSK3B)
   04310 Wnt signaling pathway
    2932 (GSK3B)
   04340 Hedgehog signaling pathway
    2932 (GSK3B)
   04390 Hippo signaling pathway
    2932 (GSK3B)
   04151 PI3K-Akt signaling pathway
    2932 (GSK3B)
   04150 mTOR signaling pathway
    2932 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    2932 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2932 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    2932 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    2932 (GSK3B)
   04657 IL-17 signaling pathway
    2932 (GSK3B)
   04662 B cell receptor signaling pathway
    2932 (GSK3B)
   04062 Chemokine signaling pathway
    2932 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    2932 (GSK3B)
   04917 Prolactin signaling pathway
    2932 (GSK3B)
   04919 Thyroid hormone signaling pathway
    2932 (GSK3B)
   04916 Melanogenesis
    2932 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    2932 (GSK3B)
   04722 Neurotrophin signaling pathway
    2932 (GSK3B)
  09158 Development
   04360 Axon guidance
    2932 (GSK3B)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2932 (GSK3B)
   05210 Colorectal cancer
    2932 (GSK3B)
   05225 Hepatocellular carcinoma
    2932 (GSK3B)
   05226 Gastric cancer
    2932 (GSK3B)
   05217 Basal cell carcinoma
    2932 (GSK3B)
   05215 Prostate cancer
    2932 (GSK3B)
   05213 Endometrial cancer
    2932 (GSK3B)
   05224 Breast cancer
    2932 (GSK3B)
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    2932 (GSK3B)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    2932 (GSK3B)
   04931 Insulin resistance
    2932 (GSK3B)
   04934 Cushing syndrome
    2932 (GSK3B)
  09167 Infectious diseases
   05166 HTLV-I infection
    2932 (GSK3B)
   05162 Measles
    2932 (GSK3B)
   05164 Influenza A
    2932 (GSK3B)
   05160 Hepatitis C
    2932 (GSK3B)
   05163 Human cytomegalovirus infection
    2932 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    2932 (GSK3B)
   05169 Epstein-Barr virus infection
    2932 (GSK3B)
   05165 Human papillomavirus infection
    2932 (GSK3B)
  09168 Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2932 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2932 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    2932 (GSK3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     2932 (GSK3B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   2932 (GSK3B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    2932 (GSK3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 2932
NCBI-ProteinID: NP_001139628
OMIM: 605004
HGNC: 4617
Ensembl: ENSG00000082701
Vega: OTTHUMG00000133765
Pharos: P49841(Tclin)
UniProt: P49841 Q6FI27
Structure
PDB: 

Position
3q13.33
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccggtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggacggcagcaaggtgacaacagtg
gtggcaactcctgggcagggtccagacaggccacaagaagtcagctatacagacactaaa
gtgattggaaatggatcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggtcgccatcaagaaagtattgcaggacaagagatttaagaatcgagagctccagatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactccagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatttatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatctgccatcgg
gatattaaaccgcagaacctcttgttggatcctgatactgctgtattaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagatgta
tggtctgctggctgtgtgttggctgagctgttactaggacaaccaatatttccaggggat
agtggtgtggatcagttggtagaaataatcaaggtcctgggaactccaacaagggagcaa
atcagagaaatgaacccaaactacacagaatttaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccgaactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgactaacaccactggaagcttgtgcacattcatttttt
gatgaattacgggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctggctaccatccttattcctcct
catgctcggattcaagcagctgcttcaacccccacaaatgccacagcagcgtcagatgct
aatactggagaccgtggacagaccaataatgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system