KEGG   Homo sapiens (human): 2935
Entry
2935              CDS       T01001                                 

Gene name
GSPT1, 551G9.2, ETF3A, GST1, eRF3a
Definition
(RefSeq) G1 to S phase transition 1
  KO
K03267  peptide chain release factor subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    2935 (GSPT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    2935 (GSPT1)
   03012 Translation factors [BR:hsa03012]
    2935 (GSPT1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Surveillance complex
     2935 (GSPT1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Release factors
   2935 (GSPT1)
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1
Other DBs
NCBI-GeneID: 2935
NCBI-ProteinID: NP_001123479
OMIM: 139259
HGNC: 4621
Ensembl: ENSG00000103342
Vega: OTTHUMG00000172956
Pharos: P15170(Tbio)
UniProt: P15170 B2RCT6 Q7KZX8
Structure
PDB: 
5HXB 3E1Y 4D61 3J5Y

Position
16p13.13
AA seq 499 aa
MELSEPIVENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKP
KSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRET
WYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAV
LVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEK
LVPFLKKVGFNPKKDIHFMPCSGLTGANLKEQSDFCPWYIGLPFIPYLDNLPNFNRSVDG
PIRLPIVDKYKDMGTVVLGKLESGSICKGQQLVMMPNKHNVEVLGILSDDVETDTVAPGE
NLKIRLKGIEEEEILPGFILCDPNNLCHSGRTFDAQIVIIEHKSIICPGYNAVLHIHTCI
EEVEITALICLVDKKSGEKSKTRPRFVKQDQVCIARLRTAGTICLETFKDFPQMGRFTLR
DEGKTIAIGKVLKLVPEKD
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggaactttcagaacctattgtagaaaatggagagacagaaatgtctccagaagaatca
tgggagcacaaagaagaaataagtgaagcagagccagggggtggttccttgggagatgga
aggccgccagaggaaagtgcccatgaaatgatggaggaggaagaggaaatcccaaaacct
aagtctgtggttgcaccgccaggtgctcctaagaaagagcatgtaaatgtagtattcatt
gggcacgtagatgctggcaagtcaaccattggaggacaaataatgtatttgactggaatg
gttgacaaaaggacgcttgaaaagtatgaaagagaagctaaagagaaaaacagagaaact
tggtacttgtcttgggccttagacacaaatcaggaagaacgagacaagggtaaaacagta
gaagtgggtcgtgcctattttgaaaccgaaaagaagcatttcacaattctagatgcccct
ggccacaagagttttgtcccaaatatgattggtggtgcctctcaagctgatttggctgtg
ctggtaatctcagccaggaaaggagagtttgaaactggatttgaaaaaggaggacagaca
agagaacatgcaatgttggcaaagacagcaggtgtaaaacacctaattgtgctaattaat
aagatggatgatccaacagtaaattggagcaatgagagatatgaagaatgtaaggagaaa
ctagtgccatttttgaaaaaagttggcttcaatcccaaaaaggacattcactttatgccc
tgctcaggacttactggagcaaatctcaaagagcagtcggatttctgtccttggtacatt
ggattaccgtttattccatatctggataatttgccgaacttcaatagatcagttgatgga
ccaatcaggctgccaattgtggataagtacaaggatatgggcactgtggtcctgggaaag
ctggaatcaggatctatttgtaaaggccagcagcttgtgatgatgccaaacaagcacaac
gtggaagttcttggaatactttccgatgatgtagagactgataccgtagccccaggtgaa
aacctcaaaatcagactgaaaggaattgaagaagaggagattcttccagggtttatactt
tgtgatcctaataatctttgtcattctggacgcacatttgatgcccagatagtgattata
gagcacaaatccatcatctgcccaggctataatgcggtgctgcatattcatacctgtatt
gaggaggtggaaataacagccttaatctgcttggtagacaaaaaatcaggagaaaaaagt
aagacccgaccccgttttgtcaaacaagatcaagtatgcattgctcgcttaaggacagca
ggaaccatctgccttgagacctttaaagacttccctcagatgggtcgtttcaccttaaga
gatgagggtaagaccattgcaattggaaaagttctgaaactggttccagagaaagactaa

DBGET integrated database retrieval system