KEGG   Homo sapiens (human): 2937Help
Entry
2937              CDS       T01001                                 

Gene name
GSS, GSHS, HEL-S-64p, HEL-S-88n
Definition
(RefSeq) glutathione synthetase
  KO
K21456  glutathione synthase [EC:6.3.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
Module
hsa_M00118  Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2937 (GSS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2937 (GSS)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    2937 (GSS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2937 (GSS)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     2937 (GSS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   2937 (GSS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSH_synth_ATP GSH_synthase MerR_1
Motif
Other DBs
NCBI-GeneID: 2937
NCBI-ProteinID: NP_000169
OMIM: 601002
HGNC: 4624
Ensembl: ENSG00000100983
Vega: OTTHUMG00000032315
Pharos: P48637(Tbio)
UniProt: P48637 V9HWJ1
Structure
PDB: 

Position
20q11.22
AA seq 474 aa AA seqDB search
MATNWGSLLQDKQQLEELARQAVDRALAEGVLLRTSQEPTSSEVVSYAPFTLFPSLVPSA
LLEQAYAVQMDFNLLVDAVSQNAAFLEQTLSSTIKQDDFTARLFDIHKQVLKEGIAQTVF
LGLNRSDYMFQRSADGSPALKQIEINTISASFGGLASRTPAVHRHVLSVLSKTKEAGKIL
SNNPSKGLALGIAKAWELYGSPNALVLLIAQEKERNIFDQRAIENELLARNIHVIRRTFE
DISEKGSLDQDRRLFVDGQEIAVVYFRDGYMPRQYSLQNWEARLLLERSHAAKCPDIATQ
LAGTKKVQQELSRPGMLEMLLPGQPEAVARLRATFAGLYSLDVGEEGDQAIAEALAAPSR
FVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVV
QCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaactgggggagcctcttgcaggataaacagcagctagaggagctggcacgg
caggccgtggaccgggccctggctgagggagtattgctgaggacctcacaggagcccact
tcctcggaggtggtgagctatgccccattcacgctcttcccctcactggtccccagtgcc
ctgctggagcaagcctatgctgtgcagatggacttcaacctgctagtggatgctgtcagc
cagaacgctgccttcctggagcaaactctttccagcaccatcaaacaggatgactttacc
gctcgtctctttgacatccacaagcaagtcctaaaagagggcattgcccagactgtgttc
ctgggcctgaatcgctcagactacatgttccagcgcagcgcagatggctccccagccctg
aaacagatcgaaatcaacaccatctctgccagctttgggggcctggcctcccggacccca
gctgtgcaccgacatgttctcagtgtcctgagtaagaccaaagaagctggcaagatcctc
tctaataatcccagcaagggactggccctgggaattgccaaagcctgggagctctacggc
tcacccaatgctctggtgctactgattgctcaagagaaggaaagaaacatatttgaccag
cgtgccatagagaatgagctactggccaggaacatccatgtgatccgacgaacatttgaa
gatatctctgaaaaggggtctctggaccaagaccgaaggctgtttgtggatggccaggaa
attgctgtggtttacttccgggatggctacatgcctcgtcagtacagtctacagaattgg
gaagcacgtctactgctggagaggtcacatgctgccaagtgcccagacattgccacccag
ctggctgggactaagaaggtgcagcaggagctaagcaggccgggcatgctggagatgttg
ctccctggccagcctgaggctgtggcccgcctccgcgccacctttgctggcctctactca
ctggatgtgggtgaagaaggggaccaggccatcgccgaggcccttgctgcccctagccgg
tttgtgctaaagccccagagagagggtggaggtaacaacctatatggggaggaaatggta
caggccctgaaacagctgaaggacagtgaggagagggcctcctacatcctcatggagaag
atcgaacctgagccttttgagaattgcctgctacggcctggcagccctgcccgagtggtc
cagtgcatttcagagctgggcatctttggggtctatgtcaggcaggaaaagacactcgtg
atgaacaagcacgtggggcatctacttcgaaccaaagccatcgagcatgcagatggtggt
gtggcagcgggagtggcagtcctggacaacccataccctgtgtga

DBGET integrated database retrieval system