KEGG   Homo sapiens (human): 2944Help
Entry
2944              CDS       T01001                                 

Gene name
GSTM1, GST1, GSTM1-1, GSTM1a-1a, GSTM1b-1b, GTH4, GTM1, H-B, MU, MU-1
Definition
(RefSeq) glutathione S-transferase mu 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2944 (GSTM1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2944 (GSTM1)
   00982 Drug metabolism - cytochrome P450
    2944 (GSTM1)
   00983 Drug metabolism - other enzymes
    2944 (GSTM1)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2944 (GSTM1)
   05204 Chemical carcinogenesis
    2944 (GSTM1)
   05225 Hepatocellular carcinoma
    2944 (GSTM1)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2944 (GSTM1)
  09168 Drug resistance
   01524 Platinum drug resistance
    2944 (GSTM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2944 (GSTM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2944 (GSTM1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2944 (GSTM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C_3 GST_C GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2944
NCBI-ProteinID: NP_000552
OMIM: 138350
HGNC: 4632
Ensembl: ENSG00000134184
Vega: OTTHUMG00000011635
Pharos: P09488(Tbio)
UniProt: P09488 X5DR03
Structure
PDB: 

Position
1p13.3
AA seq 218 aa AA seqDB search
MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL
PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF
EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN
LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgatactggggtactgggacatccgcgggctggcccacgccatccgcctgctc
ctggaatacacagactcaagctatgaggaaaagaagtacacgatgggggacgctcctgat
tatgacagaagccagtggctgaatgaaaaattcaagctgggcctggactttcccaatctg
ccctacttgattgatggggctcacaagatcacccagagcaacgccatcttgtgctacatt
gcccgcaagcacaacctgtgtggggagacagaagaggagaagattcgtgtggacattttg
gagaaccagaccatggacaaccatatgcagctgggcatgatctgctacaatccagaattt
gagaaactgaagccaaagtacttggaggaactccctgaaaagctaaagctctactcagag
tttctggggaagcggccatggtttgcaggaaacaagatcacttttgtagattttctcgtc
tatgatgtccttgacctccaccgtatatttgagcccaagtgcttggacgccttcccaaat
ctgaaggacttcatctcccgctttgagggcttggagaagatctctgcctacatgaagtcc
agccgcttcctcccaagacctgtgttctcaaagatggctgtctggggcaacaagtag

DBGET integrated database retrieval system