KEGG   Homo sapiens (human): 2947Help
Entry
2947              CDS       T01001                                 

Gene name
GSTM3, GST5, GSTB, GSTM3-3, GTM3
Definition
(RefSeq) glutathione S-transferase mu 3
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2947 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2947 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    2947 (GSTM3)
   00983 Drug metabolism - other enzymes
    2947 (GSTM3)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    2947 (GSTM3)
   05204 Chemical carcinogenesis
    2947 (GSTM3)
   05225 Hepatocellular carcinoma
    2947 (GSTM3)
  09165 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2947 (GSTM3)
  09168 Drug resistance
   01524 Platinum drug resistance
    2947 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2947 (GSTM3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2947 (GSTM3)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2947 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_3 GST_C_6 GST_C_2 GST_N_3
Motif
Other DBs
NCBI-GeneID: 2947
NCBI-ProteinID: NP_000840
OMIM: 138390
HGNC: 4635
Ensembl: ENSG00000134202
Vega: OTTHUMG00000011640
Pharos: P21266(Tbio)
UniProt: P21266 Q6FGJ9
Structure
PDB: 

Position
1p13.3
AA seq 225 aa AA seqDB search
MSCESSMVLGYWDIRGLAHAIRLLLEFTDTSYEEKRYTCGEAPDYDRSQWLDVKFKLDLD
FPNLPYLLDGKNKITQSNAILRYIARKHNMCGETEEEKIRVDIIENQVMDFRTQLIRLCY
SSDHEKLKPQYLEELPGQLKQFSMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLD
EFPNLKAFMCRFEALEKIAAYLQSDQFCKMPINNKMAQWGNKPVC
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcgagtcgtctatggttctcgggtactgggatattcgtgggctggcgcacgcc
atccgcctgctcctggagttcacggatacctcttatgaggagaaacggtacacgtgcggg
gaagctcctgactatgatcgaagccaatggctggatgtgaaattcaagctagacctggac
tttcctaatctgccctacctcctggatgggaagaacaagatcacccagagcaatgccatc
ttgcgctacatcgctcgcaagcacaacatgtgtggtgagactgaagaagaaaagattcga
gtggacatcatagagaaccaagtaatggatttccgcacacaactgataaggctctgttac
agctctgaccacgaaaaactgaagcctcagtacttggaagagctacctggacaactgaaa
caattctccatgtttctggggaaattctcatggtttgccggggaaaagctcacctttgtg
gattttctcacctatgatatcttggatcagaaccgtatatttgaccccaagtgcctggat
gagttcccaaacctgaaggctttcatgtgccgttttgaggctttggagaaaatcgctgcc
tacttacagtctgatcagttctgcaagatgcccatcaacaacaagatggcccagtggggc
aacaagcctgtatgctga

DBGET integrated database retrieval system