KEGG   Homo sapiens (human): 2950Help
Entry
2950              CDS       T01001                                 

Gene name
GSTP1, DFN7, FAEES3, GST3, GSTP, HEL-S-22, PI
Definition
(RefSeq) glutathione S-transferase pi 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05215  Prostate cancer
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00024  Prostate cancer
Drug target
Ezatiostat hydrochloride: D08917
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2950 (GSTP1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2950 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    2950 (GSTP1)
   00983 Drug metabolism - other enzymes
    2950 (GSTP1)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2950 (GSTP1)
   05204 Chemical carcinogenesis
    2950 (GSTP1)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    2950 (GSTP1)
   05215 Prostate cancer
    2950 (GSTP1)
  09166 Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2950 (GSTP1)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    2950 (GSTP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2950 (GSTP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2950 (GSTP1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2950 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 2950
NCBI-ProteinID: NP_000843
OMIM: 134660
HGNC: 4638
Ensembl: ENSG00000084207
Vega: OTTHUMG00000137430
Pharos: P09211(Tchem)
UniProt: P09211 V9HWE9
Structure
PDB: 

Position
11q13.2
AA seq 210 aa AA seqDB search
MPPYTVVYFPVRGRCAALRMLLADQGQSWKEEVVTVETWQEGSLKASCLYGQLPKFQDGD
LTLYQSNTILRHLGRTLGLYGKDQQEAALVDMVNDGVEDLRCKYISLIYTNYEAGKDDYV
KALPGQLKPFETLLSQNQGGKTFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAY
VGRLSARPKLKAFLASPEYVNLPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccgtggtctatttcccagttcgaggccgctgcgcggccctgcgcatg
ctgctggcagatcagggccagagctggaaggaggaggtggtgaccgtggagacgtggcag
gagggctcactcaaagcctcctgcctatacgggcagctccccaagttccaggacggagac
ctcaccctgtaccagtccaataccatcctgcgtcacctgggccgcacccttgggctctat
gggaaggaccagcaggaggcagccctggtggacatggtgaatgacggcgtggaggacctc
cgctgcaaatacatctccctcatctacaccaactatgaggcgggcaaggatgactatgtg
aaggcactgcccgggcaactgaagccttttgagaccctgctgtcccagaaccagggaggc
aagaccttcattgtgggagaccagatctccttcgctgactacaacctgctggacttgctg
ctgatccatgaggtcctagcccctggctgcctggatgcgttccccctgctctcagcatat
gtggggcgcctcagtgcccggcccaagctcaaggccttcctggcctcccctgagtacgtg
aacctccccatcaatggcaacgggaaacagtga

DBGET integrated database retrieval system