KEGG   Homo sapiens (human): 2952Help
Entry
2952              CDS       T01001                                 

Gene name
GSTT1
Definition
(RefSeq) glutathione S-transferase theta 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Disease
H00516  Cleft lip and/or cleft palate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    2952 (GSTT1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    2952 (GSTT1)
   00982 Drug metabolism - cytochrome P450
    2952 (GSTT1)
   00983 Drug metabolism - other enzymes
    2952 (GSTT1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2952 (GSTT1)
   05204 Chemical carcinogenesis
    2952 (GSTT1)
   05225 Hepatocellular carcinoma
    2952 (GSTT1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2952 (GSTT1)
  Drug resistance
   01524 Platinum drug resistance
    2952 (GSTT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     2952 (GSTT1)
Transporters [BR:hsa02000]
 Other Transporters
  Pores ion channels [TC:1]
   2952 (GSTT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_N_4 GST_C_2 Tom37
Motif
Other DBs
NCBI-GeneID: 2952
NCBI-ProteinID: NP_000844
OMIM: 600436
HGNC: 4641
Pharos: P30711(Tbio)
UniProt: P30711
Structure
PDB: 

Position
22q11.23
AA seq 240 aa AA seqDB search
MGLELYLDLLSQPCRAVYIFAKKNDIPFELRIVDLIKGQHLSDAFAQVNPLKKVPALKDG
DFTLTESVAILLYLTRKYKVPDYWYPQDLQARARVDEYLAWQHTTLRRSCLRALWHKVMF
PVFLGEPVSPQTLAATLAELDVTLQLLEDKFLQNKAFLTGPHISLADLVAITELMHPVGA
GCQVFEGRPKLATWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgggcctggagctgtacctggacctgctgtcccagccctgccgcgctgtttacatcttt
gccaagaagaacgacattcccttcgagctgcgcatcgtggatctgattaaaggtcagcac
ttaagcgatgcctttgcccaggtgaaccccctcaagaaggtgccagccttgaaggacggg
gacttcaccttgacggagagtgtggccatcctgctctacctgacgcgcaaatataaggtc
cctgactactggtaccctcaggacctgcaggcccgtgcccgtgtggatgagtacctggca
tggcagcacacgactctgcggagaagctgcctccgggccttgtggcataaggtgatgttc
cctgttttcctgggtgagccagtatctccccagacactggcagccaccctggcagagttg
gatgtgaccctgcagttgctcgaggacaagttcctccagaacaaggccttccttactggt
cctcacatctccttagctgacctcgtagccatcacggagctgatgcatcccgtgggtgct
ggctgccaagtcttcgaaggccgacccaagctggccacatggcggcagcgcgtggaggca
gcagtgggggaggacctcttccaggaggcccatgaggtcattctgaaggccaaggacttc
ccacctgcagaccccaccataaagcagaagctgatgccctgggtgctggccatgatccgg
tga

DBGET integrated database retrieval system