KEGG   Homo sapiens (human): 2956Help
Entry
2956              CDS       T01001                                 

Gene name
MSH6, GTBP, GTMBP, HNPCC5, HSAP, p160
Definition
(RefSeq) mutS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03430  Mismatch repair
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Module
hsa_M00295  BRCA1-associated genome surveillance complex (BASC)
Disease
H00020  Colorectal cancer
H00876  Mismatch repair deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    2956 (MSH6)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2956 (MSH6)
  09162 Cancers: Specific types
   05210 Colorectal cancer
    2956 (MSH6)
  09176 Drug resistance: Antineoplastic
   01524 Platinum drug resistance
    2956 (MSH6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2956 (MSH6)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     2956 (MSH6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II UPF0524
Motif
Other DBs
NCBI-GeneID: 2956
NCBI-ProteinID: NP_000170
OMIM: 600678
HGNC: 7329
Ensembl: ENSG00000116062
Vega: OTTHUMG00000129129
Pharos: P52701(Tbio)
UniProt: P52701 Q3SWU9
Structure
PDB: 

Position
2p16.3
AA seq 1360 aa AA seqDB search
MSRQSTLYSFFPKSPALSDANKASARASREGGRAAAAPGASPSPGGDAAWSEAGPGPRPL
ARSASPPKAKNLNGGLRRSVAPAAPTSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
REKGKSVRVHVQFFDDSPTRGWVSKRLLKPYTGSKSKEAQKGGHFYSAKPEILRAMQRAD
EALNKDKIKRLELAVCDEPSEPEEEEEMEVGTTYVTDKSEEDNEIESEEEVQPKTQGSRR
SSRQIKKRRVISDSESDIGGSDVEFKPDTKEEGSSDEISSGVGDSESEGLNSPVKVARKR
KRMVTGNGSLKRKSSRKETPSATKQATSISSETKNTLRAFSAPQNSESQAHVSGGGDDSS
RPTVWYHETLEWLKEEKRRDEHRRRPDHPDFDASTLYVPEDFLNSCTPGMRKWWQIKSQN
FDLVICYKVGKFYELYHMDALIGVSELGLVFMKGNWAHSGFPEIAFGRYSDSLVQKGYKV
ARVEQTETPEMMEARCRKMAHISKYDRVVRREICRIITKGTQTYSVLEGDPSENYSKYLL
SLKEKEEDSSGHTRAYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQVLFEKGN
LSKETKTILKSSLSCSLQEGLIPGSQFWDASKTLRTLLEEEYFREKLSDGIGVMLPQVLK
GMTSESDSIGLTPGEKSELALSALGGCVFYLKKCLIDQELLSMANFEEYIPLDSDTVSTT
RSGAIFTKAYQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERVDTCHTPFGKRLLKQWLCA
PLCNHYAINDRLDAIEDLMVVPDKISEVVELLKKLPDLERLLSKIHNVGSPLKSQNHPDS
RAIMYEETTYSKKKIIDFLSALEGFKVMCKIIGIMEEVADGFKSKILKQVISLQTKNPEG
RFPDLTVELNRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLEKQRN
RIGCRTIVYWGIGRNRYQLEIPENFTTRNLPEEYELKSTKKGCKRYWTKTIEKKLANLIN
AEERRDVSLKDCMRRLFYNFDKNYKDWQSAVECIAVLDVLLCLANYSRGGDGPMCRPVIL
LPEDTPPFLELKGSRHPCITKTFFGDDFIPNDILIGCEEEEQENGKAYCVLVTGPNMGGK
STLMRQAGLLAVMAQMGCYVPAEVCRLTPIDRVFTRLGASDRIMSGESTFFVELSETASI
LMHATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSQNV
AVRLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKA
REFEKMNQSLRLFREVCLASERSTVDAEAVHKLLTLIKEL
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacagagcaccctgtacagcttcttccccaagtctccggcgctgagtgatgcc
aacaaggcctcggccagggcctcacgcgaaggcggccgtgccgccgctgcccccggggcc
tctccttccccaggcggggatgcggcctggagcgaggctgggcctgggcccaggcccttg
gcgcgctccgcgtcaccgcccaaggcgaagaacctcaacggagggctgcggagatcggta
gcgcctgctgcccccaccagttgtgacttctcaccaggagatttggtttgggccaagatg
gagggttacccctggtggccttgtctggtttacaaccacccctttgatggaacattcatc
cgcgagaaagggaaatcagtccgtgttcatgtacagttttttgatgacagcccaacaagg
ggctgggttagcaaaaggcttttaaagccatatacaggttcaaaatcaaaggaagcccag
aagggaggtcatttttacagtgcaaagcctgaaatactgagagcaatgcaacgtgcagat
gaagccttaaataaagacaagattaagaggcttgaattggcagtttgtgatgagccctca
gagccagaagaggaagaagagatggaggtaggcacaacttacgtaacagataagagtgaa
gaagataatgaaattgagagtgaagaggaagtacagcctaagacacaaggatctaggcga
agtagccgccaaataaaaaaacgaagggtcatatcagattctgagagtgacattggtggc
tctgatgtggaatttaagccagacactaaggaggaaggaagcagtgatgaaataagcagt
ggagtgggggatagtgagagtgaaggcctgaacagccctgtcaaagttgctcgaaagcgg
aagagaatggtgactggaaatggctctcttaaaaggaaaagctctaggaaggaaacgccc
tcagccaccaaacaagcaactagcatttcatcagaaaccaagaatactttgagagctttc
tctgcccctcaaaattctgaatcccaagcccacgttagtggaggtggtgatgacagtagt
cgccctactgtttggtatcatgaaactttagaatggcttaaggaggaaaagagaagagat
gagcacaggaggaggcctgatcaccccgattttgatgcatctacactctatgtgcctgag
gatttcctcaattcttgtactcctgggatgaggaagtggtggcagattaagtctcagaac
tttgatcttgtcatctgttacaaggtggggaaattttatgagctgtaccacatggatgct
cttattggagtcagtgaactggggctggtattcatgaaaggcaactgggcccattctggc
tttcctgaaattgcatttggccgttattcagattccctggtgcagaagggctataaagta
gcacgagtggaacagactgagactccagaaatgatggaggcacgatgtagaaagatggca
catatatccaagtatgatagagtggtgaggagggagatctgtaggatcattaccaagggt
acacagacttacagtgtgctggaaggtgatccctctgagaactacagtaagtatcttctt
agcctcaaagaaaaagaggaagattcttctggccatactcgtgcatatggtgtgtgcttt
gttgatacttcactgggaaagtttttcataggtcagttttcagatgatcgccattgttcg
agatttaggactctagtggcacactatcccccagtacaagttttatttgaaaaaggaaat
ctctcaaaggaaactaaaacaattctaaagagttcattgtcctgttctcttcaggaaggt
ctgatacccggctcccagttttgggatgcatccaaaactttgagaactctccttgaggaa
gaatattttagggaaaagctaagtgatggcattggggtgatgttaccccaggtgcttaaa
ggtatgacttcagagtctgattccattgggttgacaccaggagagaaaagtgaattggcc
ctctctgctctaggtggttgtgtcttctacctcaaaaaatgccttattgatcaggagctt
ttatcaatggctaattttgaagaatatattcccttggattctgacacagtcagcactaca
agatctggtgctatcttcaccaaagcctatcaacgaatggtgctagatgcagtgacatta
aacaacttggagatttttctgaatggaacaaatggttctactgaaggaaccctactagag
agggttgatacttgccatactccttttggtaagcggctcctaaagcaatggctttgtgcc
ccactctgtaaccattatgctattaatgatcgtctagatgccatagaagacctcatggtt
gtgcctgacaaaatctccgaagttgtagagcttctaaagaagcttccagatcttgagagg
ctactcagtaaaattcataatgttgggtctcccctgaagagtcagaaccacccagacagc
agggctataatgtatgaagaaactacatacagcaagaagaagattattgattttctttct
gctctggaaggattcaaagtaatgtgtaaaattatagggatcatggaagaagttgctgat
ggttttaagtctaaaatccttaagcaggtcatctctctgcagacaaaaaatcctgaaggt
cgttttcctgatttgactgtagaattgaaccgatgggatacagcctttgaccatgaaaag
gctcgaaagactggacttattactcccaaagcaggctttgactctgattatgaccaagct
cttgctgacataagagaaaatgaacagagcctcctggaatacctagagaaacagcgcaac
agaattggctgtaggaccatagtctattgggggattggtaggaaccgttaccagctggaa
attcctgagaatttcaccactcgcaatttgccagaagaatacgagttgaaatctaccaag
aagggctgtaaacgatactggaccaaaactattgaaaagaagttggctaatctcataaat
gctgaagaacggagggatgtatcattgaaggactgcatgcggcgactgttctataacttt
gataaaaattacaaggactggcagtctgctgtagagtgtatcgcagtgttggatgtttta
ctgtgcctggctaactatagtcgagggggtgatggtcctatgtgtcgcccagtaattctg
ttgccggaagataccccccccttcttagagcttaaaggatcacgccatccttgcattacg
aagactttttttggagatgattttattcctaatgacattctaataggctgtgaggaagag
gagcaggaaaatggcaaagcctattgtgtgcttgttactggaccaaatatggggggcaag
tctacgcttatgagacaggctggcttattagctgtaatggcccagatgggttgttacgtc
cctgctgaagtgtgcaggctcacaccaattgatagagtgtttactagacttggtgcctca
gacagaataatgtcaggtgaaagtacattttttgttgaattaagtgaaactgccagcata
ctcatgcatgcaacagcacattctctggtgcttgtggatgaattaggaagaggtactgca
acatttgatgggacggcaatagcaaatgcagttgttaaagaacttgctgagactataaaa
tgtcgtacattattttcaactcactaccattcattagtagaagattattctcaaaatgtt
gctgtgcgcctaggacatatggcatgcatggtagaaaatgaatgtgaagaccccagccag
gagactattacgttcctctataaattcattaagggagcttgtcctaaaagctatggcttt
aatgcagcaaggcttgctaatctcccagaggaagttattcaaaagggacatagaaaagca
agagaatttgagaagatgaatcagtcactacgattatttcgggaagtttgcctggctagt
gaaaggtcaactgtagatgctgaagctgtccataaattgctgactttgattaaggaatta
tag

DBGET integrated database retrieval system