KEGG   Homo sapiens (human): 2958Help
Entry
2958              CDS       T01001                                 

Gene name
GTF2A2, HsT18745, T18745, TF2A2, TFIIA, TFIIA-12, TFIIA-gamma, TFIIAS
Definition
(RefSeq) general transcription factor IIA subunit 2
  KO
K03123  transcription initiation factor TFIIA small subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05203  Viral carcinogenesis
Network
N00221  HTLV-I Tax to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2958 (GTF2A2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2958 (GTF2A2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIA
     2958 (GTF2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIA_gamma_C TFIIA_gamma_N
Motif
Other DBs
NCBI-GeneID: 2958
NCBI-ProteinID: NP_001307858
OMIM: 600519
HGNC: 4647
Ensembl: ENSG00000140307
Vega: OTTHUMG00000132725
Pharos: P52657(Tbio)
UniProt: P52657 A0A024R5Z5
Structure
PDB: 

Position
15q22.2
AA seq 109 aa AA seqDB search
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcagttatacagaaatactactttgggaaacagtcttcaggagagcctagat
gagctcatacagtctcaacagatcaccccccaacttgcccttcaagttctacttcagttt
gataaggctataaatgcagcactggctcagagggtcaggaacagagtcaatttcaggggc
tctctaaatacgtacagattctgcgataatgtgtggacttttgtactgaatgatgttgaa
ttcagagaggtgacagaacttattaaagtggataaagtgaaaattgtagcctgtgatggt
aaaaatactggctccaatactacagaatga

DBGET integrated database retrieval system