KEGG   Homo sapiens (human): 2959Help
Entry
2959              CDS       T01001                                 

Gene name
GTF2B, TF2B, TFIIB
Definition
(RefSeq) general transcription factor IIB
  KO
K03124  transcription initiation factor TFIIB
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00225  EBV EBNA2 binding to host-cell-protein
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    2959 (GTF2B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    2959 (GTF2B)
  Infectious diseases
   05169 Epstein-Barr virus infection
    2959 (GTF2B)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     2959 (GTF2B)
 Prokaryotic type
  Archaeal type
    TFB
     2959 (GTF2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N Cyclin_C RB_B Sigma70_r4 zf-ribbon_3
Motif
Other DBs
NCBI-GeneID: 2959
NCBI-ProteinID: NP_001505
OMIM: 189963
HGNC: 4648
Ensembl: ENSG00000137947
Vega: OTTHUMG00000010611
Pharos: Q00403(Tbio)
UniProt: Q00403
Structure
PDB: 

Position
1p22.2
AA seq 316 aa AA seqDB search
MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKA
TKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKE
ITTMADRINLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEI
CAVSRISKKEIGRCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAV
ELDLVPGRSPISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF
PTDFKFDTPVDKLPQL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctaccagccgtttggatgctcttccaagagtcacatgtccaaaccatccagat
gcgattttagtggaggactacagagccggtgatatgatctgtcctgaatgtggcttggtt
gtaggtgaccgggttattgatgtgggatctgaatggcgaactttcagcaatgacaaagca
acaaaagatccatctcgagttggagattctcagaatcctcttctgagtgatggagatttg
tctaccatgattggcaagggcacaggagctgcaagttttgacgaatttggcaattctaag
taccagaatcggagaacaatgagcagttctgatcgggcaatgatgaatgcattcaaagaa
atcactaccatggcagacagaatcaatctacctcgaaatatagttgatcgaacaaataat
ttattcaagcaagtatatgaacagaagagcctgaagggaagagctaatgatgctatagct
tctgcttgtctctatattgcctgtagacaagaaggggttcctaggacatttaaagaaata
tgtgccgtatcacgaatttctaagaaagaaattggtcggtgttttaaacttattttgaaa
gcgctagaaaccagtgtggatttgattacaactggggacttcatgtccaggttctgttcc
aacctttgtcttcctaaacaagtacagatggcagctacacatatagcccgtaaagctgtg
gaattggacttggttcctgggaggagccccatctctgtggcagcggcagctatttacatg
gcctcacaggcatcagctgaaaagaggacccaaaaagaaattggagatattgctggtgtt
gctgatgttacaatcagacagtcctatagactgatctatcctcgagccccagatctgttt
cctacagacttcaaatttgacaccccagtggacaaactaccacagctataa

DBGET integrated database retrieval system