KEGG   Homo sapiens (human): 2963
Entry
2963              CDS       T01001                                 

Gene name
GTF2F2, BTF4, RAP30, TF2F2, TFIIF
Definition
(RefSeq) general transcription factor IIF subunit 2
  KO
K03139  transcription initiation factor TFIIF subunit beta [EC:3.6.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2963 (GTF2F2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2963 (GTF2F2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     2963 (GTF2F2)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIF
     2963 (GTF2F2)
SSDB
Motif
Pfam: TFIIF_beta TFIIF_beta_N SRP54
Other DBs
NCBI-GeneID: 2963
NCBI-ProteinID: NP_004119
OMIM: 189969
HGNC: 4653
Ensembl: ENSG00000188342
Vega: OTTHUMG00000016849
Pharos: P13984(Tbio)
UniProt: P13984 A0A024RDU9
Structure
PDB: 

Position
13q14.12-q14.13
AA seq 249 aa
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEYR
HYQGEEKSD
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccgagcgcggggaactcgacttgaccggcgccaaacagaacacaggagtgtggcta
gtcaaggttcctaaatatttgtcacagcaatgggctaaagcctctggaagaggtgaagtt
gggaaactgcggattgccaagactcaaggaaggactgaggtgtcatttactttgaatgag
gatcttgcaaatattcatgatattggtggaaaaccagcttcagtcagtgctcctagagaa
catccatttgtcttgcaaagtgttggaggacagacattaacagtatttactgagagctca
tcagataagctgtcattggaaggaatagtggtacaaagagctgaatgccgaccagctgcc
agtgaaaactacatgcgattaaaaagattgcaaatagaagagtcttccaaaccagtgagg
ctatcacaacagctggacaaagttgtaacaaccaattacaaacctgttgctaatcatcaa
tacaatatcgaatatgaaaggaaaaagaaagaagacggaaagcgagctcgagctgataaa
caacatgttttagacatgctattttcagcctttgagaaacatcaatactataatcttaag
gacttggtggacatcacaaagcaacctgtggtgtacctgaaggaaatcttaaaagaaatt
ggtgttcagaatgtaaaagggatccacaaaaacacatgggagctgaagccagagtacaga
cactatcaaggagaagaaaagagtgactaa

DBGET integrated database retrieval system