KEGG   Homo sapiens (human): 2965Help
Entry
2965              CDS       T01001                                 

Gene name
GTF2H1, BTF2, P62, TFB1, TFIIH
Definition
(RefSeq) general transcription factor IIH subunit 1
  KO
K03141  transcription initiation factor TFIIH subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    2965 (GTF2H1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    2965 (GTF2H1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    2965 (GTF2H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2965 (GTF2H1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    2965 (GTF2H1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     2965 (GTF2H1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     2965 (GTF2H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH_TFIIH BSD
Motif
Other DBs
NCBI-GeneID: 2965
NCBI-ProteinID: NP_001135779
OMIM: 189972
HGNC: 4655
Ensembl: ENSG00000110768
Vega: OTTHUMG00000167690
Pharos: P32780(Tbio)
UniProt: P32780 A0A384MTQ8
Structure
PDB: 

Position
11p15.1
AA seq 548 aa AA seqDB search
MATSSEEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKISPEGK
AKIQLQLVLHAGDTTNFHFSNESTAVKERDAVKDLLQQLLPKFKRKANKELEEKNRMLQE
DPVLFQLYKDLVVSQVISAEEFWANRLNVNATDSSSTSNHKQDVGISAAFLADVRPQTDG
CNGLRYNLTSDIIESIFRTYPAVKMKYAENVPHNMTEKEFWTRFFQSHYFHRDRLNTGSK
DLFAECAKIDEKGLKTMVSLGVKNPLLDLTALEDKPLDEGYGISSVPSASNSKSIKENSN
AAIIKRFNHHSAMVLAAGLRKQEAQNEQTSEPSNMDGNSGDADCFQPAVKRAKLQESIEY
EDLGKNNSVKTIALNLKKSDRYYHGPTPIQSLQYATSQDIINSFQSIRQEMEAYTPKLTQ
VLSSSAASSTITALSPGGALMQGGTQQAINQMVPNDIQSELKHLYVAVGELLRHFWSCFP
VNTPFLEEKVVKMKSNLERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQ
SRRLMKKT
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcaacctcatctgaagaagttttgctgattgtaaagaaagtgcgtcaaaagaagcag
gatggagctctgtacctcatggcagaaagaattgcttgggcacctgaaggcaaagataga
tttacaatcagccatatgtatgcagatattaaatgccagaaaattagtccagaaggaaaa
gctaaaattcagcttcagctggtcctacatgcaggggacacaactaacttccatttttcc
aatgaaagcacagcagtgaaagagcgagatgcagtaaaagaccttcttcagcagctgctg
cccaaattcaagaggaaagcaaataaagaactggaagagaagaacagaatgctgcaagaa
gatcctgttttgtttcagctttataaagaccttgttgtgagtcaagtgatcagtgctgag
gaattctgggccaatcgtttaaatgtgaatgcaacagatagttcttccacatccaatcat
aagcaggatgttggcatttctgctgcatttctggctgatgtccggccccaaactgatggc
tgtaacggtctaagatataatttaacttctgatatcattgagtccatatttaggacctat
ccagcagtaaaaatgaaatatgcagaaaatgttccccacaacatgacagagaaggaattc
tggacacgttttttccagtcccattattttcacagggatcggctgaatacagggtcaaag
gatctctttgcagaatgtgccaaaatagatgaaaaaggcctaaaaacaatggtttcatta
ggagtgaaaaacccactactagatttaacagctttggaagataaaccattagatgagggc
tatggcatttcctctgtgccatctgcttccaattctaaatccataaaagagaatagtaat
gctgccatcatcaagagatttaaccatcacagtgccatggtcctggcagctggactcaga
aaacaagaagcacaaaatgaacaaactagtgagcccagcaacatggatggaaattccgga
gatgcagactgctttcagccagcagtcaaaagggcgaaattacaagagtccattgaatat
gaagacttggggaaaaataattctgtaaaaacgattgcactaaacctcaagaagtcagat
aggtattatcatggtccaactccaatccagtcactacagtatgcaacaagtcaggacatt
attaattcttttcaaagtattagacaagaaatggaagcttatacacccaagttaactcag
gttctctcaagtagtgctgccagtagtaccatcacagcactgtcacctggaggggcactt
atgcagggaggaacacagcaagccataaaccagatggtgccaaatgatattcaatctgaa
ttgaaacacttatatgtagctgttggagaacttctacgacatttctggtcctgctttcct
gttaatacgccattcctagaagaaaaggtagtgaaaatgaaaagtaatttggaacgattc
caagttacgaagctctgtccattccaagaaaagattcggagacagtatttaagcacaaat
ttggtaagtcacatagaagagatgctccagacagcctacaacaagctccacacatggcag
tcacggcgtctgatgaagaaaacgtga

DBGET integrated database retrieval system