KEGG   Homo sapiens (human): 2972Help
Entry
2972              CDS       T01001                                 

Gene name
BRF1, BRF, BRF-1, CFDS, GTF3B, HEL-S-76p, TAF3B2, TAF3C, TAFIII90, TF3B90, TFIIIB90, hBRF
Definition
(RefSeq) BRF1 RNA polymerase III transcription initiation factor subunit
  KO
K15196  transcription factor IIIB 90 kDa subunit
Organism
hsa  Homo sapiens (human)
Disease
H02271  Cerebellofaciodental syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    2972 (BRF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIB
     2972 (BRF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIB BRF1 TF_Zn_Ribbon Cyclin_N RB_B
Motif
Other DBs
NCBI-GeneID: 2972
NCBI-ProteinID: NP_001510
OMIM: 604902
HGNC: 11551
Ensembl: ENSG00000185024
Vega: OTTHUMG00000029884
Pharos: Q92994(Tbio)
UniProt: Q92994
Position
14q32.33
AA seq 677 aa AA seqDB search
MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSL
DGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSR
HLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPA
IDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMH
DFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRK
LRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLC
GEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAE
YLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINY
SVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQP
AKKVATGEALLPSSPTLGAEPARPQAVLVESGPVSYHADEEADEEEPDEEDGEPCVSALQ
MMGSNDYGCDGDEDDGY
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgacgggccgcgtgtgccgcggttgcggcggcacggacatcgagctggacgcggcgcgc
ggggacgcggtgtgcaccgcctgcggctcagtgctggaggacaacatcatcgtgtccgag
gtgcagttcgtggagagcagcggcggcggctcctcggccgtgggccagttcgtgtccctg
gacggtgctggcaaaaccccgactctgggtggcggcttccacgtgaatctggggaaggag
tcgagagcgcagaccctgcagaatgggaggcgccacatccaccacctggggaaccagctg
cagctgaaccagcactgcctggacaccgccttcaacttcttcaagatggccgtgagcagg
cacctgacccgcggccggaagatggcccacgtgattgctgcctgcctctacctggtctgc
cgtacggagggcacgccgcacatgctcctggacctcagcgacctgctccaggtgaatgtg
tacgtgcttggaaagacgtttcttctcttggcaagagagctctgcatcaatgcgccggcc
atagacccgtgcctgtatattccacgctttgcgcacctgctggaattcggggagaagaac
cacgaggtgtccatgactgccctgaggctcctacagaggatgaagcgggactggatgcac
acaggccggcgcccctcgggcctctgcggagcagcgctcctggttgcagccagaatgcat
gacttcaggaggactgtgaaggaggtcatcagtgtggtcaaagtgtgtgagtccacgctg
cggaagaggctcacggaatttgaagacacccccaccagtcagttgaccattgatgagttc
atgaagatcgacctggaggaggagtgcgaccccccctcgtacacagctgggcagaggaag
ctgcggatgaagcagcttgaacaagtcctgtcaaaaaaactggaggaggttgaaggtgaa
atatccagttaccaggatgcaattgagattgaactagaaaacagccggccaaaggccaag
gggggcctggccagcctggcaaaagatggctccaccgaggacaccgcgtccagcttgtgt
ggcgaggaggacacagaggacgaggagctggaagccgcggccagccacctgaacaaagac
ttataccgggagctccttggtggtgcccccggcagctcggaagcagcaggaagccccgag
tggggcggcagacctccggccctggggtccctgctggaccccctccccactgcagccagc
ctgggcatctcagactccatccgcgaatgcatctcctctcagagcagcgaccccaaagat
gcttcaggagacggtgagctggacctcagtggcattgatgacctggagattgacaggtac
atcctgaatgagtcggaagcccgcgtgaaggccgagctgtggatgagggagaacgccgag
tacctgcgggaacagagggaaaaagaagcaagaatagcgaaagagaaggagctcggcatc
tacaaggaacacaagcccaagaagtcttgcaagcgacgggagccaattcaggccagtacc
gccagggaggccatcgagaagatgctggagcagaagaagatctccagcaagatcaattat
agcgtgctccggggcctcagcagcgccggcgggggcagtccgcacagggaggatgcacag
cccgagcatagcgccagtgccaggaagctgtcacgaaggaggacgccggccagcagaagt
ggggctgaccctgtgaccagtgtggggaaaaggttgaggcctctggtgtctacgcagcca
gcaaagaaggtggccacgggagaggctttgctcccaagctctcccaccctcggagctgag
cctgccaggccccaggcggtgctggtggagagcgggcccgtgtcataccacgccgacgag
gaggctgacgaggaggagcctgacgaggaggacggggagccctgcgtcagtgccctgcag
atgatgggcagcaacgactatggctgtgatggcgatgaggacgacggctactga

DBGET integrated database retrieval system