KEGG   Homo sapiens (human): 2977Help
Entry
2977              CDS       T01001                                 

Gene name
GUCY1A2, GC-SA2, GUC1A2
Definition
(RefSeq) guanylate cyclase 1 soluble subunit alpha 2
  KO
K12318  guanylate cyclase soluble subunit alpha [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04730  Long-term depression
hsa04921  Oxytocin signaling pathway
hsa04924  Renin secretion
hsa04970  Salivary secretion
Drug target
Amyl nitrite: D00517
Cinaciguat: D07577
Molsidomine: D01320
Nicorandil: D01810
Olinciguat: D11475
Praliciguat: D11274
Riociguat: D09572
Vericiguat: D11051
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2977 (GUCY1A2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    2977 (GUCY1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2977 (GUCY1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2977 (GUCY1A2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    2977 (GUCY1A2)
   04924 Renin secretion
    2977 (GUCY1A2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    2977 (GUCY1A2)
  09154 Digestive system
   04970 Salivary secretion
    2977 (GUCY1A2)
  09156 Nervous system
   04730 Long-term depression
    2977 (GUCY1A2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2977 (GUCY1A2)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2977 (GUCY1A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB Rx_N
Motif
Other DBs
NCBI-GeneID: 2977
NCBI-ProteinID: NP_000846
OMIM: 601244
HGNC: 4684
Ensembl: ENSG00000152402
Vega: OTTHUMG00000166296
Pharos: P33402(Tclin)
UniProt: P33402
Position
11q22.3
AA seq 732 aa AA seqDB search
MSRRKISSESFSSLGSDYLETSPEEEGECPLSRLCWNGSRSPPGPLEPSPAAAAAAAAPA
PTPAASAAAAAATAGARRVQRRRRVNLDSLGESISRLTAPSPQTIQQTLKRTLQYYEHQV
IGYRDAEKNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEFFNI
CFHENERVLRAVGGTLQDFFNGFDALLEHIRTSFGKQATLESPSFLCKELPEGTLMLHYF
HPHHIVGFAMLGMIKAAGKKIYRLDVEVEQVANEKLCSDVSNPGNCSCLTFLIKECENTN
IMKNLPQGTSQVPADLRISINTFCRAFPFHLMFDPSMSVLQLGEGLRKQLRCDTHKVLKF
EDCFEIVSPKVNATFERVLLRLSTPFVIRTKPEASGSENKDKVMEVKGQMIHVPESNSIL
FLGSPCVDKLDELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTH
QALEEEKKKTVDLLYSIFPGDVAQQLWQGQQVQARKFDDVTMLFSDIVGFTAICAQCTPM
QVISMLNELYTRFDHQCGFLDIYKVETIGDAYCVAAGLHRKSLCHAKPIALMALKMMELS
EEVLTPDGRPIQMRIGIHSGSVLAGVVGVRMPRYCLFGNNVTLASKFESGSHPRRINVSP
TTYQLLKREESFTFIPRSREELPDNFPKEIPGICYFLEVRTGPKPPKPSLSSSRIKKVSY
NIGTMFLRETSL
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaggaagatttcgtccgagtccttcagctccctgggctccgactacctggag
accagcccggaggaggagggggagtgccccctgtctaggctctgctggaatggcagccgg
agcccgcccgggccgctggagcccagcccggccgcagctgccgctgccgccgccccggcc
ccgaccccggctgcttctgccgccgccgccgctgccactgccggggccaggagggtgcag
cgccggaggcgggtcaacctggactcgctgggcgagagcatcagccgcctgacggcgccc
tcgcctcagacgatacagcagactctcaagaggacactgcagtattatgaacatcaagtt
attggttacagggatgcagaaaagaatttccacaatatctctaacagatgctcctatgca
gaccactccaacaaagaagaaattgaagatgtctcaggaattcttcagtgtactgctaat
atactcggtttgaagtttgaggaaattcaaaaaagatttggtgaagagttctttaatata
tgctttcatgagaatgagagagtccttcgagctgtaggtggcactttgcaggactttttt
aacggctttgatgctttgttggaacacattagaacttcttttggaaaacaggccactctg
gagtcaccatctttcctatgcaaagagctccctgaaggtactctcatgctccactacttc
caccctcaccatattgtggggtttgcaatgctggggatgattaaggctgcaggaaagaag
atctatcggctggatgtggaagtggaacaggttgcaaatgagaagctatgctctgatgtt
tcaaacccaggcaattgtagctgtcttactttccttatcaaagaatgtgaaaatactaat
atcatgaagaaccttccacagggaacctcccaagttcctgcggacctcagaattagcatc
aacaccttctgtagagccttccctttccacttgatgtttgatcccagcatgtcagtcctt
cagttgggggaaggtctaaggaagcagcttcgatgtgacactcacaaagtgctcaagttt
gaggactgcttcgagattgtatctccaaaggttaatgccacctttgaaagggtcctgctg
cgactgtctaccccgtttgtgattagaaccaagcctgaggcttctggctctgaaaataaa
gacaaggtgatggaagtcaaaggacaaatgatccatgttccagaatcaaattccatttta
tttttgggctctccatgtgtggacaagttggatgaactcatgggccgagggctacatctc
tcagacatccctatccatgatgccacccgagatgtcattttggttggtgagcaggcaaag
gcccaagatgggttgaagaaaaggatggataaattaaaggcaactttagaaagaactcac
caggccctggaagaagagaaaaagaagacagtggatcttctatattctattttccctggt
gatgtagcccagcaattatggcaagggcagcaagtacaggccagaaagtttgatgatgtc
accatgctcttttcagacattgttggcttcacagccatatgtgcccagtgtactcccatg
caagtaatcagcatgctgaatgaactgtacaccagatttgaccaccagtgtggatttttg
gatatttataaggtggaaacaataggtgatgcctactgtgttgcagcagggctccacaga
aaaagcctctgccatgctaaacccattgctctgatggccttgaagatgatggaactttca
gaagaggtgctgacacctgatggaagaccgattcagatgaggataggaattcactcaggc
tccgtgctggctggagttgttggggtgcgaatgccacgttattgcctgtttggaaataat
gtcacactggcaagcaaattcgagtcgggaagtcaccctcggcgcatcaatgtcagccca
accacttaccaattattaaaacgagaagaaagtttcacattcattccgcggtctcgtgaa
gagcttccagacaactttccaaaggaaattcctgggatctgctatttcctggaggtaagg
actggtccaaagccaccaaagccttctctttcttcgtcgagaataaaaaaggtttcctac
aacatcggcaccatgttcctccgggagacaagcctctga

DBGET integrated database retrieval system