KEGG   Homo sapiens (human): 29775Help
Entry
29775             CDS       T01001                                 

Gene name
CARD10, BIMP1, CARMA3
Definition
(RefSeq) caspase recruitment domain family member 10
  KO
K20912  caspase recruitment domain-containing protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    29775 (CARD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD BLYB
Motif
Other DBs
NCBI-GeneID: 29775
NCBI-ProteinID: NP_055365
OMIM: 607209
HGNC: 16422
Ensembl: ENSG00000100065
Vega: OTTHUMG00000150592
Pharos: Q9BWT7(Tbio)
UniProt: Q9BWT7
Position
22q13.1
AA seq 1032 aa AA seqDB search
MPGRAEAGEAEEEAGAGSGSEAEEDALWERIEGVRHRLARALNPAKLTPYLRQCRVIDEQ
DEEEVLSTYRFPCRVNRTGRLMDILRCRGKRGYEAFLEALEFYYPEHFTLLTGQEPAQRC
SMILDEEGPEGLTQFLMTEVRRLREARKSQLQREQQLQARGRVLEEERAGLEQRLRDQQQ
AQERCQRLREDWEAGSLELLRLKDENYMIAMRLAQLSEEKNSAVLRSRDLQLAVDQLKLK
VSRLEEECALLRRARGPPPGAEEKEKEKEKEKEPDNVDLVSELRAENQRLTASLRELQEG
LQQEASRPGAPGSERILLDILEHDWREAQDSRQELCQKLHAVQGELQWAEELRDQYLQEM
EDLRLKHRTLQKDCDLYKHRMATVLAQLEEIEKERDQAIQSRDRIQLQYSQSLIEKDQYR
KQVRGLEAERDELLTTLTSLEGTKALLEVQLQRAQGGTCLKACASSHSLCSNLSSTWSLS
EFPSPLGGPEATGEAAVMGGPEPHNSEEATDSEKEINRLSILPFPPSAGSILRRQREEDP
APPKRSFSSMSDITGSVTLKPWSPGLSSSSSSDSVWPLGKPEGLLARGCGLDFLNRSLAI
RVSGRSPPGGPEPQDKGPDGLSFYGDRWSGAVVRRVLSGPGSARMEPREQRVEAAGLEGA
CLEAEAQQRTLLWNQGSTLPSLMDSKACQSFHEALEAWAKGPGAEPFYIRANLTLPERAD
PHALCVKAQEILRLVDSAYKRRQEWFCTRVDPLTLRDLDRGTVPNYQRAQQLLEVQEKCL
PSSRHRGPRSNLKKRALDQLRLVRPKPVGAPAGDSPDQLLLEPCAEPERSLRPYSLVRPL
LVSALRPVVLLPECLAPRLIRNLLDLPSSRLDFQVCPAESLSGEELCPSSAPGAPKAQPA
TPGLGSRIRAIQESVGKKHCLLELGARGVRELVQNEIYPIVIHVEVTEKNVREVRGLLGR
PGWRDSELLRQCRGSEQVLWGLPCSWVQVPAHEWGHAEELAKVVRGRILQEQARLVWVEC
GSSRGCPSSSEA
NT seq 3099 nt NT seq  +upstreamnt  +downstreamnt
atgccgggccgggcggaggcgggggaggccgaggaggaggccggggccggctcggggtct
gaggcggaggaggacgcgctgtgggagcgaatcgagggcgtccggcatcggctggctcgc
gccctgaacccggccaagctcacgccgtatctgcgccagtgccgggtcatcgacgagcag
gacgaggaggaggtgctgagcacctaccgcttcccgtgccgcgtcaaccgcaccgggcgc
ctgatggacatcttgcgctgccgtggcaagaggggctatgaggccttcctggaagccctg
gagttctactaccccgaacacttcacgctgctcacgggccaggaacccgcccagcgctgc
tccatgatcctcgatgaggaggggcctgagggcctgacccaattcttgatgacagaggtg
cgacggctgcgggaagctcgcaagagccagctgcagcgggagcagcaactgcaggcccgg
ggccgggtgctcgaggaggagcgggcagggctggagcagcggctgcgggaccagcagcag
gctcaggagcgctgtcaacggctgcgggaggactgggaggcgggcagcctggagctgctg
cggctcaaggatgagaactacatgatcgccatgcgcctggcacagctcagtgaggagaag
aactcggctgtacttcgcagccgtgacctgcagctggcggtggatcagctcaagctcaaa
gtgagtcggctggaggaagagtgtgcactgcttcgaagggccaggggcccgccccctggg
gcagaggagaaggagaaggagaaggagaaggagaaggagccagacaatgtggaccttgtc
tctgagctgcgtgctgagaaccagcggctgacggcgtcactgcgggagttgcaggagggc
ctgcagcaggaggcgagccggccgggggccccgggctccgagcgcatcctgctggacatc
ctagagcatgactggcgggaggcgcaggacagcaggcaggagctgtgccagaagctgcat
gccgtgcagggggagctgcagtgggccgaggagctgcgcgaccagtacctgcaggagatg
gaagacctgcggctcaagcaccgcacgctgcagaaggactgtgacctgtacaagcaccgc
atggccactgtcctggcccaactggaggagattgagaaggagcgagaccaggccatccag
agccgtgaccggatccagttgcagtactcacagagcctcatcgagaaggaccagtaccgc
aagcaggtgcggggcctggaggcggagcgggatgagctgctgacaacgctcaccagcctg
gagggcaccaaggctctgctggaggttcagctgcagcgggcccagggtggcacctgcctc
aaggcctgtgcctcctcccattccctgtgctccaacctcagcagcacttggagcctgagc
gagttcccctcccctctgggaggcccagaagcaactggggaggcagctgtcatgggggga
cctgagcctcacaactcggaggaagccacagacagtgaaaaggagatcaatcggctctcc
atcctgcccttcccccccagtgccggctccatcctccgccggcagcgtgaggaagacccc
gcaccccctaagagatccttcagcagcatgtcagacatcacagggagtgtgacacttaag
ccctggtcccctggcctctcttcgtcctcatcctctgacagcgtgtggcctttgggaaag
ccggaaggcctcctggctcggggctgtggcctggacttcctcaacaggtctctggctatt
cgggtgtctggccggagccccccagggggcccagagccgcaggacaagggaccagatgga
ctgtcgttttatggggacagatggtctggggctgtggtgcgcagggtgctgtctgggcct
gggtccgccaggatggaaccaagagagcaaagggtggaagctgctggtctggagggggcg
tgcctggaagccgaggcccagcagagaaccttgctctggaatcaggggtccacactcccc
tccctgatggactcgaaggcctgccagtccttccacgaggccctagaagcctgggcaaag
ggaccaggtgccgagcccttctacattcgtgccaacctcaccttgcctgagagggcagat
ccccatgccctttgcgtgaaagcccaagagatccttcgactggtggactcggcatacaag
cggaggcaggaatggttctgcacccgggttgaccccctcactctgcgggacctggaccgg
ggcaccgtgcccaattatcagagagcccagcagctcctagaagttcaggagaaatgcctg
ccctccagccggcaccgaggcccccgcagtaatctgaagaagagagccctggaccagctg
cggctggtgaggcccaagcccgtgggggcgcctgcaggggactccccggatcagctgctg
ctggagccctgtgcagagccggagcggagcctcagaccctacagtttggtgcggccgcta
ctggtgtctgccctgcggcccgtggtgctgttgcctgagtgcctggcgccccggctcatc
cgtaacctgctagacctgcccagctcccggctggacttccaagtgtgcccagcggaaagc
ctctctggggaggaactgtgcccatcctcagcgcctggagcccccaaggctcagcctgcc
acccctgggctaggcagcaggatccgggccatccaggagtctgttgggaagaagcactgc
ctgctggagctgggtgctcggggtgtgcgggagctggtgcagaacgagatctaccccatc
gtcatccacgtggaggtgactgagaagaatgtccgggaagtcaggggtctgctgggccgg
ccgggctggcgggactcagagctgctgcggcagtgccgtggctcagagcaggtgctctgg
gggctgccctgctcctgggtgcaggtgcccgcccatgagtggggacacgcagaggagctg
gccaaggtggtgcgcggccgcatcctgcaggagcaggcccgcctcgtgtgggtggagtgc
ggcagcagcagaggctgccccagcagcagtgaggcctga

DBGET integrated database retrieval system