KEGG   Homo sapiens (human): 29777
Entry
29777             CDS       T01001                                 

Gene name
ABT1, Esf2, hABT1
Definition
(RefSeq) activator of basal transcription 1
  KO
K14785  ESF2/ABP1 family protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    29777 (ABT1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  90S particles
   Other 90S particles
    29777 (ABT1)
SSDB
Other DBs
NCBI-GeneID: 29777
NCBI-ProteinID: NP_037507
OMIM: 618750
HGNC: 17369
Ensembl: ENSG00000146109
Vega: OTTHUMG00000016319
Pharos: Q9ULW3(Tdark)
UniProt: Q9ULW3 A0A024R029
Position
6p22.2
AA seq 272 aa
MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPL
HVRNLLSAYGEVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKR
VAASLHNTPMGARRRSPFRYDLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKR
ETDFYLQSVERGQRFLAADGDPARPDGSWTFAQRPTEQELRARKAARPGGRERARLATAQ
DKARSNKGLLARIFGAPPPSESMEGPSLVRDS
NT seq 819 nt   +upstreamnt  +downstreamnt
atggaggcagaggaatcggagaaggccgcaacggagcaagagccgctggaagggacagaa
cagacactagatgcggaggaggagcaggaggaatccgaagaagcggcctgtggcagcaag
aaacgggtagtgccaggtattgtgtacctgggccatatcccgccgcgcttccggcccctg
cacgtccgcaaccttctcagcgcctatggcgaggtcggacgcgtcttctttcaggctgag
gaccggttcgtgagacgcaagaagaaggcagcagcagctgccggaggaaaaaagcggtcc
tacaccaaggactacaccgagggatgggtggagttccgtgacaagcgcatagccaagcgc
gtggcggccagtctacacaacacgcctatgggtgcccgcaggcgcagccccttccgttat
gatctttggaacctcaagtacttgcaccgtttcacctggtcccacctcagcgagcacctc
gcctttgagcgccaggtgcgcaggcagcgcttgagagcggaggttgctcaagccaagcgt
gagaccgacttctatcttcaaagtgtggaacggggacaacgctttcttgcggccgatggg
gaccctgctcgcccagatggctcctggacatttgcccagcgtcctactgagcaggaactg
agggcccgtaaagcagcacggccagggggacgtgaacgggctcgcctggcaactgcccag
gacaaggcccgctccaacaaagggctcctggccaggatctttggagccccgccaccctca
gagagcatggagggaccttcccttgtcagggactcctga

DBGET integrated database retrieval system