KEGG   Homo sapiens (human): 2978
Entry
2978              CDS       T01001                                 

Gene name
GUCA1A, C6orf131, COD3, CORD14, GCAP, GCAP1, GUCA, GUCA1
Definition
(RefSeq) guanylate cyclase activator 1A
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00481  Cone-rod dystrophy and cone dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    2978 (GUCA1A)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 Dockerin_1 EF-hand_9
Other DBs
NCBI-GeneID: 2978
NCBI-ProteinID: NP_000400
OMIM: 600364
HGNC: 4678
Ensembl: ENSG00000048545 ENSG00000287363
Vega: OTTHUMG00000014696
Pharos: P43080(Tbio)
UniProt: P43080
Position
6p21.1
AA seq 201 aa
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADEAAEAAG
NT seq 606 nt   +upstreamnt  +downstreamnt
atgggcaacgtgatggagggaaagtcagtggaggagctgagcagcaccgagtgccaccag
tggtacaagaagttcatgactgagtgcccctctggccaactcaccctctatgagttccgc
cagttcttcggcctcaagaacctgagcccgtcggccagccagtacgtggaacagatgttt
gagacttttgacttcaacaaggacggctacattgatttcatggagtacgtggcagcgctc
agcttggtcctcaaggggaaggtggaacagaagctccgctggtacttcaagctctatgat
gtagatggcaacggctgcattgaccgcgatgagctgctcaccatcatccaggccattcgc
gccattaacccctgcagcgataccaccatgactgcagaggagttcaccgatacagtgttc
tccaagattgacgtcaacggggatggggaactctccctggaagagtttatagagggcgtc
cagaaggaccagatgctcctggacacactgacacgaagcctggaccttacccgcatcgtg
cgcaggctccagaatggcgagcaagacgaggagggggctgacgaggccgctgaggcagcc
ggctga

DBGET integrated database retrieval system