KEGG   Homo sapiens (human): 2978Help
Entry
2978              CDS       T01001                                 

Gene name
GUCA1A, C6orf131, COD3, CORD14, GCAP, GCAP1, GUCA, GUCA1
Definition
(RefSeq) guanylate cyclase activator 1A
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00481  Cone-rod dystrophy and cone dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    2978 (GUCA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 SPARC_Ca_bdg EF-hand_4 Dockerin_1 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 2978
NCBI-ProteinID: NP_000400
OMIM: 600364
HGNC: 4678
Ensembl: ENSG00000048545 ENSG00000287363
Vega: OTTHUMG00000014696
Pharos: P43080(Tbio)
UniProt: P43080
Position
6p21.1
AA seq 201 aa AA seqDB search
MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMF
ETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIR
AINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIV
RRLQNGEQDEEGADEAAEAAG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgtgatggagggaaagtcagtggaggagctgagcagcaccgagtgccaccag
tggtacaagaagttcatgactgagtgcccctctggccaactcaccctctatgagttccgc
cagttcttcggcctcaagaacctgagcccgtcggccagccagtacgtggaacagatgttt
gagacttttgacttcaacaaggacggctacattgatttcatggagtacgtggcagcgctc
agcttggtcctcaaggggaaggtggaacagaagctccgctggtacttcaagctctatgat
gtagatggcaacggctgcattgaccgcgatgagctgctcaccatcatccaggccattcgc
gccattaacccctgcagcgataccaccatgactgcagaggagttcaccgatacagtgttc
tccaagattgacgtcaacggggatggggaactctccctggaagagtttatagagggcgtc
cagaaggaccagatgctcctggacacactgacacgaagcctggaccttacccgcatcgtg
cgcaggctccagaatggcgagcaagacgaggagggggctgacgaggccgctgaggcagcc
ggctga

KEGG   Homo sapiens (human): 2979Help
Entry
2979              CDS       T01001                                 

Gene name
GUCA1B, GCAP_2, GCAP2, GUCA2, RP48
Definition
(RefSeq) guanylate cyclase activator 1B
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Disease
H00527  Retinitis pigmentosa
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    2979 (GUCA1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8
Motif
Other DBs
NCBI-GeneID: 2979
NCBI-ProteinID: NP_002089
OMIM: 602275
HGNC: 4679
Ensembl: ENSG00000112599
Vega: OTTHUMG00000014697
Pharos: Q9UMX6(Tbio)
UniProt: Q9UMX6 Q7Z3V9
Position
6p21.1
AA seq 200 aa AA seqDB search
MGQEFSWEEAEAAGEIDVAELQEWYKKFVMECPSGTLFMHEFKRFFKVTDDEEASQYVEG
MFRAFDKNGDNTIDFLEYVAALNLVLRGTLEHKLKWTFKIYDKDGNGCIDRLELLNIVEG
IYQLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKML
QMDMNPSSWLAQQRRKSAMF
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggggcaggagtttagctgggaggaggcggaggcagctggcgagatagatgtggcggag
ctccaggagtggtacaagaagtttgtgatggagtgccccagcggcacactctttatgcat
gagtttaagcgcttcttcaaggtcacagacgatgaggaggcctcccagtatgtagagggc
atgttccgagccttcgacaagaatggggacaacaccatcgacttcctggagtacgtggca
gctctgaatctcgtgctgaggggcaccctggagcacaagctgaagtggacattcaagatc
tatgataaggatggcaatggctgcatcgaccgcctggagctactcaacattgtggaggga
atttaccagctgaagaaagcctgccggcgagagctacaaactgagcaaggccagctgctc
acacccgaggaggtcgtggacaggatcttcctcctggtggatgagaatggagatggccag
ctgtctctgaacgagtttgttgaaggtgcccgtcgggacaagtgggtgatgaagatgctg
cagatggacatgaatcccagcagctggctcgctcagcagagacggaaaagtgccatgttc
tga

KEGG   Homo sapiens (human): 9626Help
Entry
9626              CDS       T01001                                 

Gene name
GUCA1C, GCAP3
Definition
(RefSeq) guanylate cyclase activator 1C
  KO
K08328  guanylate cyclase activator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04744  Phototransduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04744 Phototransduction
    9626 (GUCA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_4 SPARC_Ca_bdg Dockerin_1 EF-hand_9
Motif
Other DBs
NCBI-GeneID: 9626
NCBI-ProteinID: NP_005450
OMIM: 605128
HGNC: 4680
Ensembl: ENSG00000138472
Vega: OTTHUMG00000159204
Pharos: O95843(Tdark)
UniProt: O95843
Structure
PDB: 

Position
3q13.13
AA seq 209 aa AA seqDB search
MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQV
YNTFDTNKDGFVDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAV
QALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLR
VICNGKQPDMETDSSKSPDKAGLGKVKMK
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggggaatggcaaatctatagctggtgatcagaaagcagttcctacacaagagacccat
gtgtggtacagaacatttatgatggaatatccatccggcctgcaaacactacatgaattt
aagacacttttgggtctgcaaggtctgaatcagaaggccaataaacatattgatcaagtt
tataatacctttgacacgaacaaggatggatttgttgactttttggagtttattgctgct
gtaaatctaatcatgcaagaaaaaatggagcaaaaattaaaatggtattttaagctgtat
gatgctgatggaaatggttctattgacaaaaatgaactactggacatgttcatggcggta
caagccctcaatggccagcaaactctgagtcctgaagaattcatcaacttggtgttccat
aagatcgatataaacaatgatggggaattgactttagaagaatttatcaatggcatggca
aaagatcaggatctcctggagattgtttacaagagcttcgacttctccaatgtgctgaga
gtaatctgtaatgggaagcagccagacatggagacagactcctccaaatctcctgacaag
gctggtctagggaaggtgaaaatgaagtag

DBGET integrated database retrieval system