KEGG   Homo sapiens (human): 29780
Entry
29780             CDS       T01001                                 

Gene name
PARVB, CGI-56
Definition
(RefSeq) parvin beta
  KO
K06275  parvin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29780 (PARVB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29780 (PARVB)
   04147 Exosome [BR:hsa04147]
    29780 (PARVB)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     29780 (PARVB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   29780 (PARVB)
SSDB
Motif
Pfam: CH CAMSAP_CH CH_2 4HBT
Other DBs
NCBI-GeneID: 29780
NCBI-ProteinID: NP_037459
OMIM: 608121
HGNC: 14653
Ensembl: ENSG00000188677
Vega: OTTHUMG00000150665
Pharos: Q9HBI1(Tbio)
UniProt: Q9HBI1
Structure
PDB: 
4EDM 4EDL 4EDN

Position
22q13.31
AA seq 364 aa
MSSAPRSPTPRPRRMKKDESFLGKLGGTLARKRRAREVSDLQEEGKNAINSPMSPALVDV
HPEDTQLEENEERTMIDPTSKEDPKFKELVKVLLDWINDVLVEERIIVKQLEEDLYDGQV
LQKLLEKLAGCKLNVAEVTQSEIGQKQKLQTVLEAVHDLLRPRGWALRWSVDSIHGKNLV
AILHLLVSLAMHFRAPIRLPEHVTVQVVVVRKREGLLHSSHISEELTTTTEMMMGRFERD
AFDTLFDHAPDKLSVVKKSLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEDYFV
PLHHFYLTPESFDQKVHNVSFAFELMLDGGLKKPKARPEDVVNLDLKSTLRVLYNLFTKY
KNVE
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcctccgcgccgcgctcgcccaccccgcggccccgcaggatgaagaaggacgagtcg
ttcctgggcaagctgggcggcaccctggccaggaagcggagggcgcgcgaggtgagtgac
ctgcaggaagaaggcaagaatgccatcaactcaccgatgtcccccgccctggtggatgtt
caccctgaagacacccagcttgaggagaacgaggagcgcacgatgattgaccccacttcc
aaggaagaccccaagttcaaggaactggtcaaggtcctcctcgactggattaatgacgtg
ctggtggaggagaggatcattgtgaagcagctggaggaagacctgtatgacggccaggtg
ctgcagaagctcttggaaaaactggcagggtgcaagctgaatgtggctgaggtgacacag
tccgaaatagggcagaaacagaagctgcagacggtgctggaagcagtacatgacctgctg
cggccccgaggctgggcgctccggtggagcgtggactcaattcacgggaagaacctggtg
gccatcctccacctgctggtctctctggccatgcacttcagggcccccatccgccttcct
gagcatgtaacggtgcaggtggtggtcgtgcggaaacgggaaggcctgctgcattccagc
cacatctcggaggagctgaccacaactacagagatgatgatgggccggttcgagcgggat
gccttcgacacgctgttcgaccacgccccggataagctcagcgtggtgaagaagtctctc
atcacttttgtgaacaagcacctgaacaagctgaatttggaggtgacggaactggagacc
cagtttgcagatggcgtgtacctggttctgctcatgggccttctggaagactactttgtt
cctctccaccacttctacctgactccggaaagcttcgatcagaaggtccacaatgtgtcc
ttcgcctttgagctgatgctggacggaggcctcaagaaacccaaggctcgtcctgaagac
gtggttaacttggacctcaaatccaccctgagggttctttacaacctgttcaccaagtac
aagaacgtggagtga

DBGET integrated database retrieval system