KEGG   Homo sapiens (human): 29781
Entry
29781             CDS       T01001                                 

Gene name
NCAPH2, CAPH2
Definition
(RefSeq) non-SMC condensin II complex subunit H2
  KO
K11490  condensin-2 complex subunit H2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    29781 (NCAPH2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Condensin II
    29781 (NCAPH2)
SSDB
Motif
Pfam: CNDH2_C CNDH2_N CNDH2_M
Other DBs
NCBI-GeneID: 29781
NCBI-ProteinID: NP_689512
OMIM: 611230
HGNC: 25071
Ensembl: ENSG00000025770
Vega: OTTHUMG00000150205
Pharos: Q6IBW4(Tdark)
UniProt: Q6IBW4
Position
22q13.33
AA seq 605 aa
MEDVEARFAHLLQPIRDLTKNWEVDVAAQLGEYLEELDQICISFDEGKTTMNFIEAALLI
QGSACVYSKKVEYLYSLVYQALDFISGKRRAKQLSSVQEDRANGVASSGVPQEAENEFLS
LDDFPDSRTNVDLKNDQTPSEVLIIPLLPMALVAPDEMEKNNNPLYSRQGEVLASRKDFR
MNTCVPHPRGAFMLEPEGMSPMEPAGVSPMPGTQKDTGRTEEQPMEVSVCRSPVPALGFS
QEPGPSPEGPMPLGGGEDEDAEEAVELPEASAPKAALEPKESRSPQQSAALPRRYMLRER
EGAPEPASCVKETPDPWQSLDPFDSLESKPFKKGRPYSVPPCVEEALGQKRKRKGAAKLQ
DFHQWYLAAYADHADSRRLRRKGPSFADMEVLYWTHVKEQLETLRKLQRREVAEQWLRPA
EEDHLEDSLEDLGAADDFLEPEEYMEPEGADPREAADLDAVPMSLSYEELVRRNVELFIA
TSQKFVQETELSQRIRDWEDTVQPLLQEQEQHVPFDIHTYGDQLVSRFPQLNEWCPFAEL
VAGQPAFEVCRSMLASLQLANDYTVEITQQPGLEMAVDTMSLRLLTHQRAHKRFQTYAAP
SMAQP
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggaggacgtggaggcgcgcttcgcccacctcttgcagcccatccgcgacctcaccaag
aactgggaggtggacgtggcggcccagctgggcgagtatctggaggagctggatcagatc
tgcatttcttttgacgaaggcaagaccacaatgaacttcattgaggcagcgttgttgatc
cagggctctgcctgcgtctacagtaagaaggtggaatacctctactcactcgtctaccag
gcccttgatttcatctctggaaagaggcgggccaagcagctctcttcggtgcaggaggac
agggccaatggggttgccagctccggggtcccccaggaggcagagaatgagttcctgtcg
ctggatgacttccctgactcccggactaacgtggatctcaagaatgatcagacgcccagt
gaggtcctcatcatccccctcctgcccatggccctggtggcccctgatgaaatggagaag
aacaacaatcccctgtacagccgtcagggtgaggtcctggccagccggaaggatttcagg
atgaacacgtgcgttccccaccccagaggggccttcatgttggagccagagggcatgtcc
cccatggaaccagcgggcgtttcccccatgccagggacccagaaggacaccgggaggact
gaggagcagccaatggaagtttccgtgtgcaggagccctgtcccagcactcggcttctcc
caggagccaggcccctctccagaaggcccgatgcccctgggtgggggcgaggacgaggat
gcagaggaggcagtagagcttcctgaggcctcggcccccaaggccgctctggagcccaag
gagtccaggagcccgcagcagagtgctgccctgcccaggaggtacatgctgcgggagcgg
gagggggccccagagcctgcatcctgcgtgaaggagactccagacccctggcagagcctg
gacccctttgactccttggagtctaagcccttcaagaaaggtaggccttactctgtgccc
ccctgtgtggaggaggctctgggacagaagcgcaagaggaagggcgctgccaagctgcag
gacttccaccagtggtacctggctgcctatgcagaccatgccgacagcaggcggcttcgg
cgaaagggtccgtcctttgcagacatggaggtcctgtactggacacacgtgaaggagcag
ttggaaactctccggaagctgcagaggagggaggtggctgagcagtggctgcggcctgca
gaggaggaccacctggaggattccctggaagacctgggggcagcagatgactttctagag
cctgaggagtacatggagcccgagggagcagaccccagggaagccgctgaccttgacgca
gtgccgatgtccctgagctacgaggagctggttcgaaggaatgtggagctcttcatcgcc
acctcccagaagtttgtccaggagacagagctgagccagcgcatcagggactgggaggac
acagtgcagcctctgctccaggagcaggagcagcatgtgccctttgacatccacacctat
ggggaccagctggtctcacggttcccccagctcaatgagtggtgtccctttgcggagctg
gtggctggccagccggccttcgaggtgtgtcgttccatgctggcctccctgcagctggcc
aatgactacacagtggagataacccagcagcccgggctggagatggccgtggacaccatg
tccctgagactgctcacgcaccagcgagcgcacaagcgcttccagacctacgctgccccc
tccatggcccagccctga

DBGET integrated database retrieval system