KEGG   Homo sapiens (human): 29789
Entry
29789             CDS       T01001                                 
Symbol
OLA1, DOC45, GBP45, GTBP9, GTPBP9, PTD004
Name
(RefSeq) Obg like ATPase 1
  KO
K19788  obg-like ATPase 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    29789 (OLA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     29789 (OLA1)
SSDB
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS MeaB
Other DBs
NCBI-GeneID: 29789
NCBI-ProteinID: NP_037473
OMIM: 611175
HGNC: 28833
Ensembl: ENSG00000138430
Pharos: Q9NTK5(Tbio)
UniProt: Q9NTK5
Structure
Position
2:complement(174072447..174248532)
AA seq 396 aa
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK
NT seq 1191 nt   +upstreamnt  +downstreamnt
atgccccctaaaaagggaggtgatggaattaaaccacccccaatcattggaagatttgga
acctcactgaaaattggtattgttggattgccaaatgttgggaaatctactttcttcaat
gtgttaaccaatagtcaggcttcagcagaaaacttcccgttctgcactattgatcctaat
gagagcagagtacctgtgccagatgaaaggtttgactttctttgtcaataccacaaacca
gcaagcaaaattcctgcctttctaaatgtggtggatattgctggccttgtgaaaggagct
cacaatgggcagggcctggggaatgcttttttatctcatattagtgcctgtgatggcatc
tttcatctaacacgtgcttttgaagatgatgatatcacgcacgttgaaggaagtgtagat
cctattcgagatatagaaataatacatgaagagcttcagcttaaagatgaggaaatgatt
gggcccattatagataaactagaaaaggtggctgtgagaggaggagataaaaaactaaaa
cctgaatatgatataatgtgcaaagtaaaatcctgggttatagatcaaaagaaacctgtt
cgcttctatcatgattggaatgacaaagagattgaagtgttgaataaacacttatttttg
acttcaaaaccaatggtctacttggttaatctttctgaaaaagactacattagaaagaaa
aacaaatggttgataaaaattaaagagtgggtggacaagtatgacccaggtgctttggtc
attccttttagtggggccttggaactcaagttgcaagaattgagtgctgaggagagacag
aagtatctggaagcgaacatgacacaaagtgctttgccaaagatcattaaggctgggttt
gcagcactccaactagaatactttttcactgcaggcccagatgaagtgcgtgcatggacc
atcaggaaagggactaaggctcctcaggctgcaggaaagattcacacagattttgaaaag
ggattcattatggctgaagtaatgaaatacgaagattttaaagaggaaggttctgaaaat
gcagtcaaggctgctggaaagtacagacaacaaggcagaaattatattgttgaagatgga
gatattatcttcttcaaatttaacacacctcaacaaccgaagaagaaataa

DBGET integrated database retrieval system