KEGG   Homo sapiens (human): 29796Help
Entry
29796             CDS       T01001                                 

Gene name
UQCR10, HSPC051, HSPC119, HSPC151, QCR9, UCCR7.2, UCRC
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    29796 (UQCR10)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    29796 (UQCR10)
  Environmental adaptation
   04714 Thermogenesis
    29796 (UQCR10)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29796 (UQCR10)
   05012 Parkinson's disease
    29796 (UQCR10)
   05016 Huntington's disease
    29796 (UQCR10)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    29796 (UQCR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCR_UQCRX_QCR9
Motif
Other DBs
NCBI-GeneID: 29796
NCBI-ProteinID: NP_037519
OMIM: 610843
HGNC: 30863
Ensembl: ENSG00000184076
Vega: OTTHUMG00000151283
Pharos: Q9UDW1(Tdark)
UniProt: Q9UDW1
Structure
PDB: 

Position
22q12.2
AA seq 63 aa AA seqDB search
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcgacgttgacttcgaaattgtactccctgctgttccgcaggacctccacc
ttcgccctcaccatcatcgtgggcgtcatgttcttcgagcgcgccttcgatcaaggcgcg
gacgctatctacgaccacatcaacgaggggaagctgtggaaacacatcaagcacaagtat
gagaacaagtag

DBGET integrated database retrieval system