KEGG   Homo sapiens (human): 29799Help
Entry
29799             CDS       T01001                                 

Gene name
YPEL1, FKSG3
Definition
(RefSeq) yippee like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Yippee-Mis18 ATPgrasp_YheCD RIG-I_C-RD zf-CHY Evr1_Alr
Motif
Other DBs
NCBI-GeneID: 29799
NCBI-ProteinID: NP_037445
OMIM: 608082
HGNC: 12845
Ensembl: ENSG00000100027
Vega: OTTHUMG00000150830
Pharos: O60688(Tbio)
UniProt: O60688
Position
22q11.21-q11.22
AA seq 119 aa AA seqDB search
MVKMTKSKTFQAYLPNCHRTYSCIHCRAHLANHDELISKSFQGSQGRAYLFNSVVNVGCG
PAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGKFIIELAHMIKDNGWE
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaaatgacaaagtccaaaactttccaagcgtatctgccgaactgtcaccgaacg
tacagctgtatccactgcagagcacacctggccaatcatgacgagctcatctccaagtcc
tttcaggggagccagggacgcgcctacctcttcaattccgtggtgaacgtgggctgcggc
cctgcagaggagagggtccttctcaccgggctgcatgcggttgccgacatctactgcgag
aactgcaagaccacgctcgggtggaaatacgagcatgcctttgagagcagtcagaaatat
aaggaaggaaaattcatcattgagcttgctcatatgatcaaagacaatggctgggagtaa

DBGET integrated database retrieval system