KEGG   Homo sapiens (human): 2980
Entry
2980              CDS       T01001                                 

Gene name
GUCA2A, GCAP-I, GUCA2, STARA
Definition
(RefSeq) guanylate cyclase activator 2A
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Guanylin
Other DBs
NCBI-GeneID: 2980
NCBI-ProteinID: NP_291031
OMIM: 139392
HGNC: 4682
Ensembl: ENSG00000197273
Vega: OTTHUMG00000007023
Pharos: Q02747(Tbio)
CPD: C16007
UniProt: Q02747
Structure
PDB: 
1O8R

Position
1p34.2
AA seq 115 aa
MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIP
GEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
NT seq 348 nt   +upstreamnt  +downstreamnt
atgaatgccttcctgctctccgcactgtgcctccttggggcctgggccgccttggcagga
ggggtcaccgtgcaggatggaaatttctccttttctctggagtcagtgaagaagctcaaa
gacctccaggagccccaggagcccagggttgggaaactcaggaactttgcacccatccct
ggtgaacctgtggttcccatcctctgtagcaacccgaactttccagaagaactcaagcct
ctctgcaaggagcccaatgcccaggagatacttcagaggctggaggaaatcgctgaggac
ccgggcacatgtgaaatctgtgcctacgctgcctgtaccggatgctag

DBGET integrated database retrieval system