KEGG   Homo sapiens (human): 29802
Entry
29802             CDS       T01001                                 

Gene name
VPREB3, 8HS20, N27C7-2
Definition
(RefSeq) V-set pre-B cell surrogate light chain 3
  KO
K06553  pre-B lymphocyte gene
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    29802 (VPREB3)
CD molecules [BR:hsa04090]
 Proteins
  29802 (VPREB3)
SSDB
Motif
Pfam: V-set Ig_3 I-set ig
Other DBs
NCBI-GeneID: 29802
NCBI-ProteinID: NP_037510
OMIM: 605017
HGNC: 12710
Ensembl: ENSG00000128218
Vega: OTTHUMG00000150738
Pharos: Q9UKI3(Tbio)
UniProt: Q9UKI3
Position
22q11.23; 22q11
AA seq 123 aa
MACRCLSFLLMGTFLSVSQTVLAQLDALLVFPGQVAQLSCTLSPQHVTIRDYGVSWYQQR
AGSAPRYLLYYRSEEDHHRPADIPDRFSAAKDEAHNACVLTISPVQPEDDADYYCSVGYG
FSP
NT seq 372 nt   +upstreamnt  +downstreamnt
atggcctgccggtgcctcagcttccttctgatggggaccttcctgtcagtttcccagaca
gtcctggcccagctggatgcactgctggtcttcccaggccaagtggctcaactctcctgc
acgctcagcccccagcacgtcaccatcagggactacggtgtgtcctggtaccagcagcgg
gcaggcagtgcccctcgatatctcctctactaccgctcggaggaggatcaccaccggcct
gctgacatccccgatcgattctcggcagccaaggatgaggcccacaatgcctgtgtcctc
accattagtcccgtgcagcctgaagacgacgcggattactactgctctgttggctacggc
tttagtccctag

DBGET integrated database retrieval system