KEGG   Homo sapiens (human): 2983Help
Entry
2983              CDS       T01001                                 

Gene name
GUCY1B1, GC-S-beta-1, GC-SB3, GUC1B3, GUCB3, GUCSB3, GUCY1B3
Definition
(RefSeq) guanylate cyclase 1 soluble subunit beta 1
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa04022  cGMP-PKG signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04713  Circadian entrainment
hsa04730  Long-term depression
hsa04921  Oxytocin signaling pathway
hsa04924  Renin secretion
hsa04970  Salivary secretion
Module
hsa_M00694  cGMP signaling
Drug target
Amyl nitrite: D00517
Cinaciguat: D07577
Nicorandil: D01810
Riociguat: D09572
Vericiguat: D11051
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    2983 (GUCY1B1)
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    2983 (GUCY1B1)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    2983 (GUCY1B1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2983 (GUCY1B1)
  Endocrine system
   04921 Oxytocin signaling pathway
    2983 (GUCY1B1)
   04924 Renin secretion
    2983 (GUCY1B1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    2983 (GUCY1B1)
  Digestive system
   04970 Salivary secretion
    2983 (GUCY1B1)
  Nervous system
   04730 Long-term depression
    2983 (GUCY1B1)
  Environmental adaptation
   04713 Circadian entrainment
    2983 (GUCY1B1)
Enzymes [BR:hsa01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     2983 (GUCY1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOBA HNOB 4_1_CTD
Motif
Other DBs
NCBI-GeneID: 2983
NCBI-ProteinID: NP_000848
OMIM: 139397
HGNC: 4687
Ensembl: ENSG00000061918
Vega: OTTHUMG00000161698
Pharos: Q02153(Tclin)
UniProt: Q02153
Structure
PDB: 

Position
4q32.1
AA seq 619 aa AA seqDB search
MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLN
LNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSF
RCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKVIQQRNEECDHTQFL
IEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHIIFDRDLVVTQCGNAIYRVL
PQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGTE
ISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFR
EEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLPPSVANELRHKRPVPAKRYDNV
TILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYM
TVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESVQITIGIHTGEVVTGVIGQRMPRY
CLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLEHRGPVSMKGKKEPMQ
VWFLSRKNTGTEETKQDDD
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtacggatttgtgaatcacgccctggagttgctggtgatccgcaattacggccccgag
gtgtgggaagacatcaaaaaagaggcacagttagatgaagaaggacagtttcttgtcaga
ataatatatgatgactccaaaacttatgatttggttgctgctgcaagcaaagtcctcaat
ctcaatgctggagaaatcctccaaatgtttgggaagatgtttttcgtcttttgccaagaa
tctggttatgatacaatcttgcgtgtcctgggctctaatgtcagagaatttctacagaac
cttgatgctctgcacgaccaccttgctaccatctacccaggaatgcgtgcaccttccttt
aggtgcactgatgcagaaaagggcaaaggactcattttgcactactactcagagagagaa
ggacttcaggatattgtcattggaatcatcaaaacagtggcacaacaaatccatggcact
gaaatagacatgaaggttattcagcaaagaaatgaagaatgtgatcatactcaattttta
attgaagaaaaagagtcaaaagaagaggatttttatgaagatcttgacagatttgaagaa
aatggtacccaggaatcacgcatcagcccatatacattctgcaaagcttttccttttcat
ataatatttgaccgggacctagtggtcactcagtgtggcaatgctatatacagagttctc
ccccagctccagcctgggaattgcagccttctgtctgtcttctcgctggttcgtcctcat
attgatattagtttccatgggatcctttctcacatcaatactgtttttgtattgagaagc
aaggaaggattgttggatgtggagaaattagaatgtgaggatgaactgactgggactgag
atcagctgcttacgtctcaagggtcaaatgatctacttacctgaagcagatagcatactt
tttctatgttcaccaagtgtcatgaacctggacgatttgacaaggagagggctgtatcta
agtgacatccctctgcatgatgccacgcgcgatcttgttcttttgggagaacaatttaga
gaggaatacaaactcacccaagaactggaaatcctcactgacaggctacagctcacgtta
agagccctggaagatgaaaagaaaaagacagacacattgctgtattctgtccttcctccg
tctgttgccaatgagctgcggcacaagcgtccagtgcctgccaaaagatatgacaatgtg
accatcctctttagtggcattgtgggcttcaatgctttctgtagcaagcatgcatctgga
gaaggagccatgaagatcgtcaacctcctcaacgacctctacaccagatttgacacactg
actgattcccggaaaaacccatttgtttataaggtggagactgttggtgacaagtatatg
acagtgagtggtttaccagagccatgcattcaccatgcacgatccatctgccacctggcc
ttggacatgatggaaattgctggccaggttcaagtagatggtgaatctgttcagataaca
atagggatacacactggagaggtagttacaggtgtcataggacagcggatgcctcgatac
tgtctttttgggaatactgtcaacctcacaagccgaacagaaaccacaggagaaaaggga
aaaataaatgtgtctgaatatacatacagatgtcttatgtctccagaaaattcagatcca
caattccacttggagcacagaggcccagtgtccatgaagggcaaaaaagaaccaatgcaa
gtttggtttctatccagaaaaaatacaggaacagaggaaacaaagcaggatgatgactga

DBGET integrated database retrieval system