KEGG   Homo sapiens (human): 29843
Entry
29843             CDS       T01001                                 

Gene name
SENP1, SuPr-2
Definition
(RefSeq) SUMO specific peptidase 1
  KO
K08592  sentrin-specific protease 1 [EC:3.4.22.68]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    29843 (SENP1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29843 (SENP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.68  Ulp1 peptidase
     29843 (SENP1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C48: Ulp1 endopeptidase family
   29843 (SENP1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   29843 (SENP1)
SSDB
Motif
Pfam: Peptidase_C48
Other DBs
NCBI-GeneID: 29843
NCBI-ProteinID: NP_001254523
OMIM: 612157
HGNC: 17927
Ensembl: ENSG00000079387
Vega: OTTHUMG00000169896
Pharos: Q9P0U3(Tbio)
UniProt: Q9P0U3 Q6N001
Structure
PDB: 

Position
12q13.11
AA seq 644 aa
MDDIADRMRMDAGEVTLVNHNSVFKTHLLPQTGFPEDQLSLSDQQILSSRQGHLDRSFTC
STRSAAYNPSYYSDNPSSDSFLGSGDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYL
ETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVS
TAEETVQEEEREIYRQLLQMVTGKQFTIAKPTTHFPLHLSRCLSSSKNTLKDSLFKNGNS
CASQIIGSDTSSSGSASILTNQEQLSHSVYSLSSYTPDVAFGSKDSGTLHHPHHHHSVPH
QPDNLAASNTQSEGSDSVILLKVKDSQTPTPSSTFFQAELWIKELTSVYDSRARERLRQI
EEQKALALQLQNQRLQEREHSVHDSVELHLRVPLEKEIPVTVVQETQKKGHKLTDSEDEF
PEITEEMEKEIKNVFRNGNQDEVLSEAFRLTITRKDIQTLNHLNWLNDEIINFYMNMLME
RSKEKGLPSVHAFNTFFFTKLKTAGYQAVKRWTKKVDVFSVDILLVPIHLGVHWCLAVVD
FRKKNITYYDSMGGINNEACRILLQYLKQESIDKKRKEFDTNGWQLFSKKSQEIPQQMNG
SDCGMFACKYADCITKDRPINFTQQHMPYFRKRMVWEILHRKLL
NT seq 1935 nt   +upstreamnt  +downstreamnt
atggatgatattgctgataggatgaggatggatgctggagaagtgactttagtgaaccac
aactccgtattcaaaacccacctcctgccacaaacaggttttccagaggaccagctttcg
ctttctgaccagcagattttatcttccaggcaaggacatttggaccgatcttttacatgt
tccacaagaagtgcagcttataatccaagctattactcagataatccttcctcagacagt
tttcttggctcaggcgatttaagaacctttggccagagtgcaaatggccaatggagaaat
tctaccccatcgtcaagctcatctttacaaaaatcaagaaacagccgaagtctttacctc
gaaacccgaaagacctcaagtggattatcaaacagttttgcgggaaagtcaaaccatcac
tgccatgtatctgcatatgaaaaatcttttcctattaaacctgttccaagtccatcttgg
agtggttcatgtcgtcgaagtcttttgagccccaagaaaactcagaggcgacatgttagt
acagcagaagagacagttcaagaagaagaaagagagatttacagacagctgctacagatg
gtcacagggaaacagtttactatagccaaacccaccacacattttcctttacacctgtct
cgatgtcttagttccagtaaaaatactttgaaagactcactgtttaaaaatggaaactct
tgtgcatctcagatcattggctctgatacttcatcatctggatctgccagcattttaact
aaccaggaacagctgtcccacagtgtatattccctatcttcttataccccagatgttgca
tttggatccaaagattctggtactcttcatcatccccatcatcaccactctgttccacat
cagccagataacttagcagcttcaaatacacaatctgaaggatcagactctgtgatttta
ctgaaagtgaaagattcccagactccaactcccagttctactttcttccaggcagagctg
tggatcaaagaattaactagtgtttatgattctcgagcacgagaaagattgcgccagatt
gaagaacagaaggcattggccttacagcttcaaaaccagagattgcaggagcgggaacat
tcagtacatgattcagtagaactacatcttcgtgtacctcttgaaaaggagattcctgtt
actgttgtccaagaaacacaaaaaaaaggtcataaattaactgatagtgaagatgaattt
cctgaaattacagaggaaatggagaaagaaataaagaatgtatttcgtaatgggaatcag
gatgaagttctcagtgaagcatttcgcctgaccattacacgcaaagatattcaaactcta
aaccatctgaattggctcaatgatgagatcatcaatttctacatgaatatgctgatggag
cgaagtaaagagaagggcttgccaagtgtgcatgcatttaatacctttttcttcactaaa
ttaaaaacggctggttatcaggcagtgaaacgttggacaaagaaagtagatgtattttct
gttgacattcttttggtgcccattcacctgggagtacactggtgtctagctgttgtggac
tttagaaagaagaatattacctattacgactccatgggtgggataaacaatgaagcctgc
agaatactcttgcaatacctaaagcaagaaagcattgacaagaaaaggaaagagtttgac
accaatggctggcagcttttcagcaagaaaagccaggagattcctcagcagatgaatgga
agtgactgtgggatgtttgcctgcaaatatgctgactgtattaccaaagacagaccaatc
aacttcacacagcaacacatgccatacttccggaagcggatggtctgggagatcctccac
cgaaaactcttgtga

DBGET integrated database retrieval system