KEGG   Homo sapiens (human): 29851Help
Entry
29851             CDS       T01001                                 

Gene name
ICOS, AILIM, CD278, CVID1
Definition
(RefSeq) inducible T cell costimulator
  KO
K06713  inducible T-cell co-stimulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04660  T cell receptor signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05340  Primary immunodeficiency
Disease
H00088  Common variable immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    29851 (ICOS)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    29851 (ICOS)
   04672 Intestinal immune network for IgA production
    29851 (ICOS)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    29851 (ICOS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    29851 (ICOS)
CD molecules [BR:hsa04090]
 Proteins
  29851 (ICOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set_2 V-set
Motif
Other DBs
NCBI-GeneID: 29851
NCBI-ProteinID: NP_036224
OMIM: 604558
HGNC: 5351
Ensembl: ENSG00000163600
Vega: OTTHUMG00000132880
Pharos: Q9Y6W8(Tbio)
UniProt: Q9Y6W8 Q53QY6
Position
2q33.2
AA seq 199 aa AA seqDB search
MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQ
ILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFK
VTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEY
MFMRAVNTAKKSRLTDVTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcaggcctctggtatttctttctcttctgcttgcgcattaaagttttaacagga
gaaatcaatggttctgccaattatgagatgtttatatttcacaacggaggtgtacaaatt
ttatgcaaatatcctgacattgtccagcaatttaaaatgcagttgctgaaaggggggcaa
atactctgcgatctcactaagacaaaaggaagtggaaacacagtgtccattaagagtctg
aaattctgccattctcagttatccaacaacagtgtctctttttttctatacaacttggac
cattctcatgccaactattacttctgcaacctatcaatttttgatcctcctccttttaaa
gtaactcttacaggaggatatttgcatatttatgaatcacaactttgttgccagctgaag
ttctggttacccataggatgtgcagcctttgttgtagtctgcattttgggatgcatactt
atttgttggcttacaaaaaagaagtattcatccagtgtgcacgaccctaacggtgaatac
atgttcatgagagcagtgaacacagccaaaaaatctagactcacagatgtgaccctataa

DBGET integrated database retrieval system