KEGG   Homo sapiens (human): 29882
Entry
29882             CDS       T01001                                 

Gene name
ANAPC2, APC2
Definition
(RefSeq) anaphase promoting complex subunit 2
  KO
K03349  anaphase-promoting complex subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29882 (ANAPC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29882 (ANAPC2)
   04114 Oocyte meiosis
    29882 (ANAPC2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29882 (ANAPC2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29882 (ANAPC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29882 (ANAPC2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29882 (ANAPC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Cullin
     29882 (ANAPC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    29882 (ANAPC2)
SSDB
Motif
Pfam: Cullin ANAPC2
Other DBs
NCBI-GeneID: 29882
NCBI-ProteinID: NP_037498
OMIM: 606946
HGNC: 19989
Ensembl: ENSG00000176248
Vega: OTTHUMG00000020983
Pharos: Q9UJX6(Tbio)
UniProt: Q9UJX6
Structure
PDB: 

Position
9q34.3
AA seq 822 aa
MAAAVVVAEGDSDSRPGQELLVAWNTVSTGLVPPAALGLVSSRTSGAVPPKEEELRAAVE
VLRGHGLHSVLEEWFVEVLQNDLQANISPEFWNAISQCENSADEPQCLLLLLDAFGLLES
RLDPYLRSLELLEKWTRLGLLMGTGAQGLREEVHTMLRGVLFFSTPRTFQEMIQRLYGCF
LRVYMQSKRKGEGGTDPELEGELDSRYARRRYYRLLQSPLCAGCSSDKQQCWCRQALEQF
HQLSQVLHRLSLLERVSAEAVTTTLHQVTRERMEDRCRGEYERSFLREFHKWIERVVGWL
GKVFLQDGPARPASPEAGNTLRRWRCHVQRFFYRIYASLRIEELFSIVRDFPDSRPAIED
LKYCLERTDQRQQLLVSLKAALETRLLHPGVNTCDIITLYISAIKALRVLDPSMVILEVA
CEPIRRYLRTREDTVRQIVAGLTGDSDGTGDLAVELSKTDPASLETGQDSEDDSGEPEDW
VPDPVDADPGKSSSKRRSSDIISLLVSIYGSKDLFINEYRSLLADRLLHQFSFSPEREIR
NVELLKLRFGEAPMHFCEVMLKDMADSRRINANIREEDEKRPAEEQPPFGVYAVILSSEF
WPPFKDEKLEVPEDIRAALEAYCKKYEQLKAMRTLSWKHTLGLVTMDVELADRTLSVAVT
PVQAVILLYFQDQASWTLEELSKAVKMPVALLRRRMSVWLQQGVLREEPPGTFSVIEEER
PQDRDNMVLIDSDDESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMF
VVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLPKNCS
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggcggcggcagttgtggtggcggagggggacagcgactcccggcccggacaggagttg
ttagtggcctggaacaccgtgagcaccggcctggtgccgccggctgcgctggggctggtg
tcttcccggaccagcggtgcagtcccgccaaaggaagaggagctccgggcggcggtggag
gttctgaggggccacgggctacactcggtcctggaggagtggttcgtggaggtgctgcag
aacgatctgcaggccaacatctcccctgagttctggaatgccatctcccaatgcgagaac
tctgcggatgagccccagtgccttttgctactccttgacgcttttggcctgctggagagc
cgcctggatccctacctgcgtagcctagagctgctggagaaatggactcgcctgggcttg
ctgatgggcactggtgctcaggggctgcgagaagaagtccacactatgttgcgcggagtc
ttgttctttagcacccccagaaccttccaagagatgatccagcgtctgtatgggtgcttc
ttgagagtctatatgcagagtaagaggaagggggaagggggcacagacccggaactggaa
ggggagctggacagccggtatgcccgtcgccggtactaccggctcctgcagagcccgctg
tgtgcagggtgcagcagtgacaagcaacagtgctggtgtcgccaggctctggagcagttc
catcagctcagccaggtcttacacaggctcagtctgctggagcgggtcagtgccgaggct
gtgaccaccaccctgcaccaggtgacccgggagaggatggaggaccgttgccggggcgag
tacgagcgctccttcctgcgtgagttccacaagtggatcgagcgggtggtcggctggctc
ggcaaggtgttcctgcaggacggccccgccaggcccgcatctcccgaggccggcaacacc
ctgcgccgctggcgctgccacgtgcaaaggttcttctaccgcatctacgccagcctgcgc
atcgaggagctcttcagcatcgtccgagacttcccagactcccggccagccatcgaggac
ctcaagtactgcctggagaggacggaccagaggcagcagctgctcgtgtccctcaaggct
gccctggagactcggctcctgcatccaggcgtcaacacgtgtgacatcatcaccctctat
atctctgccatcaaggcgctgcgcgtgctggacccttccatggtcatcctggaggtggcc
tgtgagcctatccgccgctacctgaggacgcgggaggacacagtgcggcagattgtggct
gggctgacgggggactcggacgggacaggggacctggctgttgagctgtccaagaccgac
ccggcgagcctggagacaggccaggacagtgaggatgactcaggcgagccagaggactgg
gtcccggaccctgtggatgccgatccagggaagtcgagctccaagcggcgttcatcggac
atcatcagcctgctggtcagcatctacggcagcaaggacctcttcatcaatgagtaccgc
tcgctgctggccgaccgcctgctgcaccagttcagcttcagccccgagcgggagatccgc
aacgtggagctgctgaagctgcgctttggcgaggccccaatgcacttctgtgaagtcatg
ctgaaggacatggcggactcccgccgcatcaatgccaacatccgggaggaggatgagaag
cggccagcagaggagcagccaccgttcggggtctacgctgtcatcctgtccagtgagttc
tggccgcccttcaaggacgagaagctggaggtccccgaggatatcagggcagccctggag
gcttactgcaagaagtatgagcagctcaaggccatgcggaccctcagttggaagcacacc
ctgggcctggtgaccatggacgtggagctggccgaccgcacgctgtctgtggcggtcacc
ccagtacaggcggtgatcttgctgtattttcaggaccaagccagctggaccctggaggaa
ctgagcaaggcggtgaagatgcccgtggcgctgctgcggcggcggatgtccgtgtggctg
cagcagggtgtgctgcgtgaggagccccccggcaccttctctgtcattgaggaggagcgg
cctcaggaccgggacaacatggtgctcattgacagtgacgacgagagcgactccggcatg
gcctcccaggccgaccagaaggaggaggagctgctgctcttctggacgtacatccaggcc
atgctgaccaacctggagagcctctcactggatcgtatctacaacatgctccgcatgttt
gtggtgactgggcctgcactggccgagattgacctgcaggagctgcagggctacctgcag
aagaaggtgcgggaccagcagctcgtctactcggccggcgtctaccgcctgcccaagaac
tgcagctga

DBGET integrated database retrieval system