KEGG   Homo sapiens (human): 29883
Entry
29883             CDS       T01001                                 
Symbol
CNOT7, CAF-1, CAF1, Caf1a, hCAF-1
Name
(RefSeq) CCR4-NOT transcription complex subunit 7
  KO
K12581  CCR4-NOT transcription complex subunit 7/8
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    29883 (CNOT7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29883 (CNOT7)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     29883 (CNOT7)
  mRNA degradation factors
   3'-5' decay
    Ccr4-NOT complex
     29883 (CNOT7)
SSDB
Motif
Pfam: CAF1
Other DBs
NCBI-GeneID: 29883
NCBI-ProteinID: NP_001309019
OMIM: 604913
HGNC: 14101
Ensembl: ENSG00000198791
Pharos: Q9UIV1(Tbio)
UniProt: Q9UIV1 Q96IQ6
Structure
Position
8:complement(17224966..17246857)
AA seq 285 aa
MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADY
QYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSG
IQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFGYLIKILTNSNLPEEELD
FFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIGPQHQAGSDSLLTGMAFFK
MREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEANKQS
NT seq 858 nt   +upstreamnt  +downstreamnt
atgccagcggcaactgtagatcatagccaaagaatttgtgaagtttgggcttgcaacttg
gatgaagagatgaagaaaattcgtcaagttatccgaaaatataattacgttgctatggac
accgagtttccaggtgtggttgcaagacccattggagaattcaggagcaatgctgactat
caataccaactattgcggtgtaatgtagacttgttaaagataattcagctaggactgaca
tttatgaatgagcaaggagaataccctccaggaacttcaacttggcagtttaattttaaa
tttaatttgacggaggacatgtatgcccaggactctatagagctactaacaacatctggt
atccagtttaaaaaacatgaggaggaaggaattgaaacccagtactttgcagaacttctt
atgacttctggagtggtcctctgtgaaggggtcaaatggttgtcatttcatagcggttac
gactttggctacttaatcaaaatcctaaccaactctaacttgcctgaagaagaacttgac
ttctttgagatccttcgattgttttttcctgtcatttatgatgtgaagtacctcatgaag
agctgcaaaaatctcaaaggtggattacaggaggtggcagaacagttagagctggaacgg
ataggaccacaacatcaggcaggatctgattcattgctcacaggaatggcctttttcaaa
atgagagaaatgttctttgaagatcatattgatgatgccaaatattgtggtcatttgtat
ggccttggttctggttcatcctatgtacagaatggcacagggaatgcatatgaagaggaa
gccaacaagcagtcatga

DBGET integrated database retrieval system