KEGG   Homo sapiens (human): 29889Help
Entry
29889             CDS       T01001                                 

Gene name
GNL2, HUMAUANTIG, NGP1, Ngp-1, Nog2, Nug2
Definition
(RefSeq) G protein nucleolar 2
  KO
K14537  nuclear GTP-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    29889 (GNL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    29889 (GNL2)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   GTPases
    29889 (GNL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NGP1NT MMR_HSR1 FeoB_N RsgA_GTPase Arf
Motif
Other DBs
NCBI-GeneID: 29889
NCBI-ProteinID: NP_037417
OMIM: 609365
HGNC: 29925
Ensembl: ENSG00000134697
Vega: OTTHUMG00000004322
Pharos: Q13823(Tbio)
UniProt: Q13823 Q5T0F3
Position
1p34.3
AA seq 731 aa AA seqDB search
MVKPKYKGRSTINPSKASTNPDRVQGAGGQNMRDRATIRRLNMYRQKERRNSRGKIIKPL
QYQSTVASGTVARVEPNIKWFGNTRVIKQSSLQKFQEEMDTVMKDPYKVVMKQSKLPMSL
LHDRIRPHNLKVHILDTESFETTFGPKSQRKRPNLFASDMQSLIENAEMSTESYDQGKDR
DLVTEDTGVRNEAQEEIYKKGQSKRIWGELYKVIDSSDVVVQVLDARDPMGTRSPHIETY
LKKEKPWKHLIFVLNKCDLVPTWATKRWVAVLSQDYPTLAFHASLTNPFGKGAFIQLLRQ
FGKLHTDKKQISVGFIGYPNVGKSSVINTLRSKKVCNVAPIAGETKVWQYITLMRRIFLI
DCPGVVYPSEDSETDIVLKGVVQVEKIKSPEDHIGAVLERAKPEYISKTYKIDSWENAED
FLEKLAFRTGKLLKGGEPDLQTVGKMVLNDWQRGRIPFFVKPPNAEPLVAPQLLPSSSLE
VVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVP
QFSGDDLVPVEVSDLEEELESFSDEEEEEQEQQRDDAEESSSEPEEENVGNDTKAVIKAL
DEKIAKYQKFLDKAKAKKFSAVRISKGLSEKIFAKPEEQRKTLEEDVDDRAPSKKGKKRK
AQREEEQEHSNKAPRALTSKERRRAVRQQRPKKVGVRYYETHNVKNRNRNKKKTNDSEGQ
KHKRKKFRQKQ
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcccaagtacaaaggacggagcaccatcaacccgtccaaggccagcacaaac
ccagatcgagtgcagggagcaggaggccaaaacatgagggaccgggccaccatccggcgc
ctgaatatgtataggcaaaaggagcgcaggaacagtcgtggtaaaataattaaacccctg
caatatcaatcaacggtggcttctggcacagtggcaagagtagagccaaatattaaatgg
tttggaaacacacgtgtgattaagcagtcatcattacaaaaatttcaagaggaaatggat
acagttatgaaggatccatacaaagttgtcatgaagcaaagcaagttaccaatgtctctt
ctccatgatcgaatccggcctcataacttgaaggtgcacattcttgatactgaaagtttt
gaaactacatttggccctaagtcacagaggaaacgaccaaacttatttgcaagtgatatg
cagtctcttatcgaaaatgctgaaatgtccactgagagctatgaccagggcaaggatcgt
gatttggtaactgaagacactggtgtgagaaatgaagctcaagaagagatctataaaaag
ggacagtccaaaagaatatggggtgagctctacaaggtgatagattcatcagatgttgta
gttcaagttcttgatgctagagatccaatgggtactcgttcccctcacattgaaacttac
ctgaagaaggaaaaaccttggaaacacctcatttttgtacttaacaaatgtgaccttgtt
ccaacctgggcaacaaaacggtgggttgctgtcctctcccaggattatccaacacttgct
ttccatgcaagccttactaacccgtttggcaagggagcattcattcagcttctgcggcag
tttggaaagttgcacactgacaagaaacagatcagtgttgggttcattggctatccaaat
gttggcaagagctctgtgataaatacattgcgttctaagaaagtttgcaacgtggctccc
attgcaggtgaaacaaaggtctggcagtatattactttgatgcgtcggatattcctgatt
gactgtccaggtgtggtttacccctctgaggactccgagacagacattgtgctaaaagga
gttgttcaagtagaaaaaattaagagtcctgaagaccacattggtgctgtacttgaacga
gcaaagccagaatatatcagcaaaacatacaagattgattcttgggagaatgctgaggac
tttcttgagaagctcgctttccggactgggaagttactaaagggtggagagcccgacttg
cagactgtgggtaagatggtcctcaatgactggcagaggggccggattcctttctttgtc
aagccacccaatgcagagccacttgtggccccccagcttctaccctcctcatctttggaa
gttgtcccagaagcagcccagaacaatccaggggaggaagtcacagaaactgcaggtgaa
gggtcagaatccatcattaaggaagaaacagaagagaacagtcactgtgatgctaacaca
gagatgcagcagattctcacacgagttcggcagaactttggtaaaatcaacgtggtgcct
cagttttctggggatgacctggttcctgtggaggtgtcagatcttgaggaagagcttgag
agcttttctgatgaagaggaggaggaacaggagcaacaaagagatgatgcggaagagtct
tcctcggagcctgaggaggaaaatgtgggaaacgacaccaaagccgttattaaagcactg
gatgagaagattgccaaatatcagaagtttctagacaaagccaaagccaaaaagttttca
gcagtcagaatatccaagggactgagtgaaaagatatttgcaaaacctgaagaacaaaga
aaaacactggaagaagatgtagatgacagagcaccttccaaaaagggaaagaagcggaag
gcacaaagggaagaggaacaggaacattcaaataaagctcccagggcgcttacatcaaaa
gaacggaggcgagcagtacgacagcaacggccgaaaaaagttggtgtgcgctactatgaa
acacacaacgtgaaaaataggaacaggaacaaaaagaagaccaatgactcagagggacag
aaacacaaacgcaaaaaattcagacaaaagcagtaa

DBGET integrated database retrieval system