KEGG   Homo sapiens (human): 29890
Entry
29890             CDS       T01001                                 
Symbol
RBM15B, HUMAGCGB, HsOTT3, OTT3
Name
(RefSeq) RNA binding motif protein 15B
  KO
K13190  RNA-binding protein 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    29890 (RBM15B)
   03041 Spliceosome [BR:hsa03041]
    29890 (RBM15B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     29890 (RBM15B)
Spliceosome [BR:hsa03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    29890 (RBM15B)
SSDB
Motif
Pfam: SPOC RRM_1 RRM_3 Nup35_RRM_2 HTH_37
Other DBs
NCBI-GeneID: 29890
NCBI-ProteinID: NP_037418
OMIM: 612602
HGNC: 24303
Ensembl: ENSG00000259956
Pharos: Q8NDT2(Tbio)
UniProt: Q8NDT2
Position
3:51391285..51397908
AA seq 890 aa
MKRQSERDSSPSGRGSSSSAKRPREREREAEAGGRRAAHKASGGAKHPVPARARDKPRGS
GSGGGGHRDGRGTGDANHRASSGRSSGSGAGGGGRGGKASGDPGASGMSPRASPLPPPPP
PPGAEPACPGSSAAAPEYKTLLISSLSPALPAEHLEDRLFHQFKRFGEISLRLSHTPELG
RVAYVNFRHPQDAREARQHALARQLLLYDRPLKVEPVYLRGGGGSSRRSSSSSAAASTPP
PGPPAPADPLGYLPLHGGYQYKQRSLSPVAAPPLREPRARHAAAAFALDAAAAAAVGLSR
ERALDYYGLYDDRGRPYGYPAVCEEDLMPEDDQRATRNLFIGNLDHSVSEVELRRAFEKY
GIIEEVVIKRPARGQGGAYAFLKFQNLDMAHRAKVAMSGRVIGRNPIKIGYGKANPTTRL
WVGGLGPNTSLAALAREFDRFGSIRTIDHVKGDSFAYIQYESLDAAQAACAKMRGFPLGG
PDRRLRVDFAKAEETRYPQQYQPSPLPVHYELLTDGYTRHRNLDADLVRDRTPPHLLYSD
RDRTFLEGDWTSPSKSSDRRNSLEGYSRSVRSRSGERWGADGDRGLPKPWEERRKRRSLS
SDRGRTTHSPYEERSRTKGSGQQSERGSDRTPERSRKENHSSEGTKESSSNSLSNSRHGA
EERGHHHHHHEAADSSHGKKARDSERNHRTTEAEPKPLEEPKHETKKLKNLSEYAQTLQL
GWNGLLVLKNSCFPTSMHILEGDQGVISSLLKDHTSGSKLTQLKIAQRLRLDQPKLDEVT
RRIKQGSPNGYAVLLATQATPSGLGTEGMPTVEPGLQRRLLRNLVSYLKQKQAAGVISLP
VGGSKGRDGTGMLYAFPPCDFSQQYLQSALRTLGKLEEEHMVIVIVRDTA
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaagcggcagagcgagcgagactctagcccgagcgggcgcggctcgtcatcgtccgcc
aagcgtccgcgggagcgcgaacgggaggcggaggcgggcgggcggcgggcggcgcacaag
gcctctggcggcgccaagcacccggttccagcgcgggcccgcgacaaaccccgcggcagc
ggaagcggcgggggcgggcatcgcgacggccgcggcaccggggacgcgaatcaccgcgcg
agtagcgggcgctcctcgggctccggcgctggcggcgggggacgcggcggcaaggcctcg
ggggacccgggcgcctccggcatgtcgccccgcgcgtctcctctgccgccgcctccgcca
ccgcctggggccgagcccgcgtgtcccggctcatccgcggccgcgcctgagtacaagacg
ttgctcatcagcagcttgagccccgcgctgcccgccgagcacctcgaggaccggctcttc
caccagttcaagcgcttcggcgagatcagcctccgcctgtcgcacacgcctgagctgggc
cgtgtggcctacgtgaatttccggcacccacaggacgcacgcgaggcccgccagcacgcc
ctggcccggcagctgctgctctacgaccgcccgctcaaggtagagcccgtgtacctgcgt
ggcggcggcgggagcagtcggcgaagtagcagcagcagcgccgccgcttccacgcctccc
ccagggccgcccgcgcccgccgacccgctcggctacctcccgctacacggaggctaccag
tacaagcagcgctcgctgtcccccgtcgctgccccgcccctgcgggagccccgtgcccgt
cacgccgccgcagccttcgccctggatgccgctgctgccgccgccgtgggactgtcccgg
gagcgggccctggactactacgggctgtacgacgaccgtgggcgcccctatggctaccca
gctgtgtgtgaggaggacctgatgcccgaggatgaccagcgggccacgcgcaacctcttc
attggtaacctggaccacagcgtatctgaggtggagctgcgaagggccttcgagaaatat
ggcatcatcgaggaggtggtcatcaagaggcctgcccgtggccagggcggtgcctatgcc
ttcctcaagttccagaacctggacatggcccatagggctaaggtggccatgtcgggccga
gtgattggtcgcaaccccattaagataggctatggcaaggccaaccccaccactcgtctc
tgggtgggtggcctgggacctaacacgtcactggcggctctggcccgagagtttgaccgc
tttgggagcattcggaccattgatcacgtcaaaggagatagctttgcctatattcagtac
gagagcttggacgcagcccaggccgcctgtgctaaaatgaggggttttcccttgggtgga
ccagaccgcaggctccgcgtggattttgccaaagcagaggagactcggtacccccagcag
taccagccctcgccactccctgtgcattatgagctgctcacagatggatacacccggcac
cgcaacctggacgccgacctggtgcgggacaggacgcccccacaccttctgtactcagac
cgagaccggacttttttggaaggggactggaccagccccagtaaaagctctgaccgccga
aacagccttgagggctacagtcgctcagtgcgcagccggagtggtgagcgttggggggca
gatggagaccgtggtttgcccaagccctgggaagagaggcggaaacggagaagcctttcc
agtgaccgtgggaggacaacccattcaccatatgaggaacggagtaggaccaagggcagt
gggcagcagtcagagcggggctccgaccgcacccctgagcgcagccgcaaggagaaccac
tccagtgaagggaccaaggagtccagcagcaactccctcagcaacagcagacatggggct
gaggaacggggccaccaccaccaccaccacgaggctgcagactcttcccacgggaagaag
gcaagagacagcgagcgcaatcaccggaccacagaggccgagcccaagcctctggaagag
ccaaaacacgagaccaaaaagctgaagaatctttcagagtacgctcagacactacagctg
ggttggaatgggcttctggtgttgaaaaacagctgcttccccacgtctatgcatatccta
gagggggaccagggggtgatcagcagtctcctcaaagaccacacttctgggagcaagctg
acccagctgaagatcgcccagcgccttcgactggaccagcccaagcttgacgaggtcaca
cgacgcatcaagcaggggagccccaacggctatgcggtcctcttagccacccaggcaacc
cccagtgggcttggcactgaggggatgcccacagtagagcccggtctgcagaggcggctt
ctcaggaacctggtctcctacttgaaacagaagcaggccgcaggggtgatcagcttgcca
gtgggggggtccaagggcagagacggcacaggcatgctctacgccttcccaccctgcgac
ttttcccagcagtacctccagtcagcactaaggacattgggcaagctagaagaagaacac
atggtgatagtcatcgtcagagacactgcctag

DBGET integrated database retrieval system