KEGG   Homo sapiens (human): 29895Help
Entry
29895             CDS       T01001                                 

Gene name
MYLPF, HUMMLC2B, MLC2B, MRLC2, MYL11
Definition
(RefSeq) myosin light chain, phosphorylatable, fast skeletal muscle
  KO
K12758  fast skeletal myosin light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    29895 (MYLPF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    29895 (MYLPF)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    29895 (MYLPF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    29895 (MYLPF)
   04147 Exosome [BR:hsa04147]
    29895 (MYLPF)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     29895 (MYLPF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   29895 (MYLPF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 29895
NCBI-ProteinID: NP_001311387
OMIM: 617378
HGNC: 29824
Ensembl: ENSG00000180209
Vega: OTTHUMG00000132399
Pharos: Q96A32(Tbio)
UniProt: Q96A32 A0A024QZG6
Position
16p11.2
AA seq 169 aa AA seqDB search
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atggcacccaagagggccaagagaaggacagtagagggcggaagctccagcgtcttctcc
atgttcgaccagactcagatccaggagttcaaagaggccttcactgtgatcgaccagaac
cgtgatggtattatagacaaggaggaccttcgggacaccttcgcagccatgggccgcctc
aatgtgaagaatgaggagttggatgccatgatgaaggaagccagcggtcccatcaacttc
accgtcttcctgaccatgttcggggagaagctcaagggtgccgaccctgaggatgtgatc
accggagccttcaaggtcttggaccctgagggaaagggcaccatcaagaagaagttcctg
gaggagctgctgaccacgcagtgtgaccgcttctcccaggaggagatcaagaacatgtgg
gcggccttcccccccgacgtgggcggcaacgtcgactacaaaaacatctgctacgtcatc
acgcacggcgacgccaaggaccaggagtag

DBGET integrated database retrieval system