KEGG   Homo sapiens (human): 29896Help
Entry
29896             CDS       T01001                                 

Gene name
TRA2A, AWMS1, HSU53209
Definition
(RefSeq) transformer 2 alpha homolog
  KO
K12897  transformer-2 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    29896 (TRA2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    29896 (TRA2A)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    29896 (TRA2A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     29896 (TRA2A)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   SR proteins
    29896 (TRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 Apt1 Macoilin
Motif
Other DBs
NCBI-GeneID: 29896
NCBI-ProteinID: NP_037425
OMIM: 602718
HGNC: 16645
Ensembl: ENSG00000164548
Vega: OTTHUMG00000128459
Pharos: Q13595(Tbio)
UniProt: Q13595 Q549U1
Position
7p15.3
AA seq 282 aa AA seqDB search
MSDVEENNFEGRESRSQSKSPTGTPARVKSESRSGSRSPSRVSKHSESHSRSRSKSRSRS
RRHSHRRYTRSRSHSHSHRRRSRSRSYTPEYRRRRSRSHSPMSNRRRHTGSRANPDPNTC
LGVFGLSLYTTERDLREVFSRYGPLSGVNVVYDQRTGRSRGFAFVYFERIDDSKEAMERA
NGMELDGRRIRVDYSITKRAHTPTPGIYMGRPTHSGGGGGGGGGGGGGGGGRRRDSYYDR
GYDRGYDRYEDYDYRYRRRSPSPYYSRYRSRSRSRSYSPRRY
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatgtggaggaaaacaacttcgagggcagagagtctcgctctcagtcaaaatct
ccaacgggaactcctgctcgtgtaaaatcggagagcaggtcaggatctcgtagtccatca
agggtttccaaacactctgaatcccattctcgatcaagatcaaaatccaggtcgaggtca
aggagacattctcatagacgttacactcgatccagatcccactctcactctcataggaga
cgatctcgaagtagatcatatacaccagaataccggcggcgaaggagccgaagccattct
ccaatgtctaaccggagaagacatactggcagcagggcaaatccagatcccaacacttgc
cttggagtgtttggcctcagtttgtacacaacagagagggatcttcgtgaagtattttct
cgatatggaccattgagtggtgtcaatgtggtttatgatcagcgaactgggcgatctcga
ggatttgcttttgtgtattttgagagaatagatgactcaaaggaggctatggaaagggca
aatggaatggagctggatggtagaagaattcgggtggattattctataaccaagagagcg
cacacaccaacaccaggcatctacatgggcagaccaactcatagtggtgggggtggtgga
ggaggcggcggcggtggaggtggaggtggtggcagacgtcgagattcttactatgataga
ggatatgatcgtgggtatgacagatatgaagactatgattaccgatacagaagacgatca
ccttctccttattatagtcgatatagatcacgatcaagatctcgttcctacagcccaaga
cgctattga

DBGET integrated database retrieval system