KEGG   Homo sapiens (human): 29927Help
Entry
29927             CDS       T01001                                 

Gene name
SEC61A1, HNFJ4, HSEC61, SEC61, SEC61A
Definition
(RefSeq) Sec61 translocon alpha 1 subunit
  KO
K10956  protein transport protein SEC61 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04145  Phagosome
hsa05110  Vibrio cholerae infection
Module
hsa_M00401  Sec61 complex
Disease
H00541  Autosomal dominant tubulointerstitial kidney disease (ADTKD)
H02011  Familial juvenile hyperuricemic nephropathy (HNFJ)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03060 Protein export
    29927 (SEC61A1)
   04141 Protein processing in endoplasmic reticulum
    29927 (SEC61A1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    29927 (SEC61A1)
 Human Diseases
  Infectious diseases
   05110 Vibrio cholerae infection
    29927 (SEC61A1)
Secretion system [BR:hsa02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   29927 (SEC61A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SecY Plug_translocon DUF2975
Motif
Other DBs
NCBI-GeneID: 29927
NCBI-ProteinID: NP_037468
OMIM: 609213
HGNC: 18276
Ensembl: ENSG00000058262
Vega: OTTHUMG00000159624
Pharos: P61619(Tbio)
UniProt: P61619 B3KNF6 B3KME8
Position
3q21.3
AA seq 476 aa AA seqDB search
MAIKFLEVIKPFCVILPEIQKPERKIQFKEKVLWTAITLFIFLVCCQIPLFGIMSSDSAD
PFYWMRVILASNRGTLMELGISPIVTSGLIMQLLAGAKIIEVGDTPKDRALFNGAQKLFG
MIITIGQSIVYVMTGMYGDPSEMGAGICLLITIQLFVAGLIVLLLDELLQKGYGLGSGIS
LFIATNICETIVWKAFSPTTVNTGRGMEFEGAIIALFHLLATRTDKVRALREAFYRQNLP
NLMNLIATIFVFAVVIYFQGFRVDLPIKSARYRGQYNTYPIKLFYTSNIPIILQSALVSN
LYVISQMLSARFSGNLLVSLLGTWSDTSSGGPARAYPVGGLCYYLSPPESFGSVLEDPVH
AVVYIVFMLGSCAFFSKTWIEVSGSSAKDVAKQLKEQQMVMRGHRETSMVHELNRYIPTA
AAFGGLCIGALSVLADFLGAIGSGTGILLAVTIIYQYFEIFVKEQSEVGSMGALLF
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcaaatttctggaagtcatcaagcccttctgtgtcatcctgccggaaattcag
aagccagagaggaagattcagtttaaggagaaagtgctgtggaccgctatcaccctcttt
atcttcttagtgtgctgccagattcccctgtttgggatcatgtcttcagattcagctgac
cctttctattggatgagagtgattctagcctctaacagaggcacattgatggagctaggg
atctctcctattgtcacgtctggccttataatgcaactcttggctggcgccaagataatt
gaagttggtgacaccccaaaagaccgagctctcttcaacggagcccaaaagttatttggc
atgatcattactatcggccagtctatcgtgtatgtgatgaccgggatgtatggggaccct
tctgaaatgggtgctggaatttgcctgctaatcaccattcagctctttgttgctggctta
attgtcctacttttggatgaactcctgcaaaaaggatatggccttggctctggtatttct
ctcttcattgcaactaacatctgtgaaaccatcgtatggaaggcattcagccccactact
gtcaacactggccgaggaatggaatttgaaggtgctatcatcgcacttttccatctgctg
gccacacgcacagacaaggtccgagcccttcgggaggcgttctaccgccagaatcttccc
aacctcatgaatctcatcgccaccatctttgtctttgcagtggtcatctatttccagggc
ttccgagtggacctgccaatcaagtcggcccgctaccgtggccagtacaacacctatccc
atcaagctcttctatacgtccaacatccccatcatcctgcagtctgccctggtgtccaac
ctttatgtcatctcccaaatgctctcagctcgcttcagtggcaacttgctggtcagcctg
ctgggcacctggtcggacacgtcttctgggggcccagcacgtgcttatccagttggtggc
ctttgctattacctgtcccctccagaatcttttggctccgtgttagaagacccggtccat
gcagttgtatacatagtgttcatgctgggctcctgtgcattcttctccaaaacgtggatt
gaggtctcaggttcctctgccaaagatgttgcaaagcagctgaaggagcagcagatggtg
atgagaggccaccgagagacctccatggtccatgaactcaaccggtacatccccacagcc
gcggcctttggtgggctgtgcatcggggccctctcggtcctggctgacttcctaggcgcc
attgggtctggaaccgggatcctgctcgcagtcacaatcatctaccagtactttgagatc
ttcgttaaggagcaaagcgaggttggcagcatgggggccctgctcttctga

DBGET integrated database retrieval system