KEGG   Homo sapiens (human): 2993
Entry
2993              CDS       T01001                                 

Gene name
GYPA, CD235a, GPA, GPErik, GPSAT, HGpMiV, HGpMiXI, HGpSta(C), MN, MNS, PAS-2
Definition
(RefSeq) glycophorin A (MNS blood group)
  KO
K06575  glycophorin A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04640  Hematopoietic cell lineage
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2993 (GYPA)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    2993 (GYPA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2993 (GYPA)
CD molecules [BR:hsa04090]
 Proteins
  2993 (GYPA)
SSDB
Motif
Pfam: Glycophorin_A Collectrin
Other DBs
NCBI-GeneID: 2993
NCBI-ProteinID: NP_002090
OMIM: 617922
HGNC: 4702
Ensembl: ENSG00000170180
Vega: OTTHUMG00000161403
Pharos: P02724(Tbio)
UniProt: P02724 A0A0C4DFT7
Structure
PDB: 
5EH6 5EH4 2KPE 2KPF 1AFO

Position
4q31.21
AA seq 150 aa
MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAH
EVSEISVRTVYPPEEETGERVQLAHHFSEPEITLIIFGVMAGVIGTILLISYGIRRLIKK
SPSDVKPLPSPDTDVPLSSVEIENPETSDQ
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtatggaaaaataatctttgtattactattgtcagaaattgtgagcatatcagcatta
agtaccactgaggtggcaatgcacacttcaacttcttcttcagtcacaaagagttacatc
tcatcacagacaaatgatacgcacaaacgggacacatatgcagccactcctagagctcat
gaagtttcagaaatttctgttagaactgtttaccctccagaagaggaaaccggagaaagg
gtacaacttgcccatcatttctctgaaccagagataacactcattatttttggggtgatg
gctggtgttattggaacgatcctcttaatttcttacggtattcgccgactgataaagaaa
agcccatctgatgtaaaacctctcccctcacctgacacagacgtgcctttaagttctgtt
gaaatagaaaatccagagacaagtgatcaatga

KEGG   Homo sapiens (human): 2994
Entry
2994              CDS       T01001                                 

Gene name
GYPB, CD235b, GPB, GYP, GYPA, MNS, PAS-3, SS
Definition
(RefSeq) glycophorin B (MNS blood group)
  KO
K20925  glycophorin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    2994 (GYPB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2994 (GYPB)
CD molecules [BR:hsa04090]
 Proteins
  2994 (GYPB)
SSDB
Motif
Pfam: Glycophorin_A BIV_Env DUF6040
Other DBs
NCBI-GeneID: 2994
NCBI-ProteinID: NP_002091
OMIM: 617923
HGNC: 4703
Ensembl: ENSG00000250361
Vega: OTTHUMG00000161404
Pharos: P06028(Tbio)
UniProt: P06028
Position
4q31.21
AA seq 91 aa
MYGKIIFVLLLSEIVSISALSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPAP
VVIILIILCVMAGIIGTILLISYSIRRLIKA
NT seq 276 nt   +upstreamnt  +downstreamnt
atgtatggaaaaataatctttgtattactattgtcagaaattgtgagcatatcagcatta
agtaccactgaggtggcaatgcacacttcaacctcttcttcagtcacaaagagttacatc
tcatcacagacaaatggagaaacgggacaacttgtccatcgtttcactgtaccagctcct
gtagtgataatactcattattttgtgtgtgatggctggtattattggaacgatcctctta
atttcttacagtattcgccgactgataaaggcatga

DBGET integrated database retrieval system