KEGG   Homo sapiens (human): 29933Help
Entry
29933             CDS       T01001                                 

Gene name
GPR132, G2A
Definition
(RefSeq) G protein-coupled receptor 132
  KO
K08426  G protein-coupled receptor 132
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    29933 (GPR132)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    29933 (GPR132)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Ilm1
Motif
Other DBs
NCBI-GeneID: 29933
NCBI-ProteinID: NP_001265623
OMIM: 606167
HGNC: 17482
Ensembl: ENSG00000183484
Vega: OTTHUMG00000140173
Pharos: Q9UNW8(Tbio)
UniProt: Q9UNW8
Position
14q32.33
AA seq 380 aa AA seqDB search
MCPMLLKNGYNGNATPVTTTAPWASLGLSAKTCNNVSFEESRIVLVVVYSAVCTLGVPAN
CLTAWLALLQVLQGNVLAVYLLCLALCELLYTGTLPLWVIYIRNQHRWTLGLLACKVTAY
IFFCNIYVSILFLCCISCDRFVAVVYALESRGRRRRRTAILISACIFILVGIVHYPVFQT
EDKETCFDMLQMDSRIAGYYYARFTVGFAIPLSIIAFTNHRIFRSIKQSMGLSAAQKAKV
KHSAIAVVVIFLVCFAPYHLVLLVKAAAFSYYRGDRNAMCGLEERLYTASVVFLCLSTVN
GVADPIIYVLATDHSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFS
RPVHPPGSPCPAKRLIEESC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccaatgctactgaaaaacggttacaatggaaacgccaccccagtgaccaccact
gccccgtgggcctccctgggcctctccgccaagacctgcaacaacgtgtccttcgaagag
agcaggatagtcctggtcgtggtgtacagcgcggtgtgcacgctgggggtgccggccaac
tgcctgactgcgtggctggcgctgctgcaggtactgcagggcaacgtgctggccgtctac
ctgctctgcctggcactctgcgagctgctgtacacaggcacgctgccactctgggtcatc
tatatccgcaaccagcaccgctggaccctaggcctgctggcctgcaaggtgaccgcctac
atcttcttctgcaacatctacgtcagcatcctcttcctgtgctgcatctcctgcgaccgc
ttcgtggccgtggtgtacgcgctggagagtcggggccgccgccgccggaggaccgccatc
ctcatctccgcctgcatcttcatcctcgtcgggatcgttcactacccggtgttccagacg
gaagacaaggagacctgctttgacatgctgcagatggacagcaggattgccgggtactac
tacgccaggttcaccgttggctttgccatccctctctccatcatcgccttcaccaaccac
cggattttcaggagcatcaagcagagcatgggcttaagcgctgcccagaaggccaaggtg
aagcactcggccatcgcggtggttgtcatcttcctagtctgcttcgccccgtaccacctg
gttctcctcgtcaaagccgctgccttttcctactacagaggagacaggaacgccatgtgc
ggcttggaggaaaggctgtacacagcctctgtggtgtttctgtgcctgtccacggtgaac
ggcgtggctgaccccattatctacgtgctggccacggaccattcccgccaagaagtgtcc
agaatccataaggggtggaaagagtggtccatgaagacagacgtcaccaggctcacccac
agcagggacaccgaggagctgcagtcgcccgtggcccttgcagaccactacaccttctcc
aggcccgtgcacccaccagggtcaccatgccctgcaaagaggctgattgaggagtcctgc
tga

DBGET integrated database retrieval system