KEGG   Homo sapiens (human): 29945Help
Entry
29945             CDS       T01001                                 

Gene name
ANAPC4, APC4
Definition
(RefSeq) anaphase promoting complex subunit 4
  KO
K03351  anaphase-promoting complex subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00221  HTLV-1 Tax to spindle assembly checkpoint signaling
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    29945 (ANAPC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    29945 (ANAPC4)
   04114 Oocyte meiosis
    29945 (ANAPC4)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    29945 (ANAPC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    29945 (ANAPC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    29945 (ANAPC4)
   03036 Chromosome and associated proteins [BR:hsa03036]
    29945 (ANAPC4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     29945 (ANAPC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid separation proteins
   APC/C complex
    29945 (ANAPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4 ANAPC4_WD40 RXLR_WY
Motif
Other DBs
NCBI-GeneID: 29945
NCBI-ProteinID: NP_037499
OMIM: 606947
HGNC: 19990
Ensembl: ENSG00000053900
Vega: OTTHUMG00000097753
Pharos: Q9UJX5(Tbio)
UniProt: Q9UJX5
Structure
PDB: 

Position
4p15.2
AA seq 808 aa AA seqDB search
MLRFPTCFPSFRVVGEKQLPQEIIFLVWSPKRDLIALANTAGEVLLHRLASFHRVWSFPP
NENTGKEVTCLAWRPDGKLLAFALADTKKIVLCDVEKPESLHSFSVEAPVSCMHWMEVTV
ESSVLTSFYNAEDESNLLLPKLPTLPKNYSNTSKIFSEENSDEIIKLLGDVRLNILVLGG
SSGFIELYAYGMFKIARVTGIAGTCLALCLSSDLKSLSVVTEVSTNGASEVSYFQLETNL
LYSFLPEVTRMARKFTHISALLQYINLSLTCMCEAWEEILMQMDSRLTKFVQEKNTTTSV
QDEFMHLLLWGKASAELQTLLMNQLTVKGLKKLGQSIESSYSSIQKLVISHLQSGSESLL
YHLSELKGMASWKQKYEPLGLDAAGIEEAITAVGSFILKANELLQVIDSSMKNFKAFFRW
LYVAMLRMTEDHVLPELNKMTQKDITFVAEFLTEHFNEAPDLYNRKGKYFNVERVGQYLK
DEDDDLVSPPNTEGNQWYDFLQNSSHLKESPLLFPYYPRKSLHFVKRRMENIIDQCLQKP
ADVIGKSMNQAICIPLYRDTRSEDSTRRLFKFPFLWNNKTSNLHYLLFTILEDSLYKMCI
LRRHTDISQSVSNGLIAIKFGSFTYATTEKVRRSIYSCLDAQFYDDETVTVVLKDTVGRE
GRDRLLVQLPLSLVYNSEDSAEYQFTGTYSTRLDEQCSAIPTRTMHFEKHWRLLESMKAQ
YVAGNGFRKVSCVLSSNLRHVRVFEMDIDDEWELDESSDEEEEASNKPVKIKEEVLSESE
AENQQAGAAALAPEIVIKVEKLDPELDS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgttttccgacctgtttcccatccttccgggtggtgggagagaagcagctcccg
caggagattattttcctggtctggtcgcccaagcgggatctcattgctttggccaacaca
gctggcgaggttttacttcatcgactggcaagttttcatcgagtttggagttttccacca
aatgaaaatacaggaaaggaggtgacgtgtctggcatggagaccagatggcaaacttttg
gcctttgctcttgctgataccaagaaaattgttttgtgtgatgtagaaaaacctgagagc
ttacactctttttctgtggaggctccagtttcctgtatgcattggatggaagtgacagta
gaaagcagtgttctcacatcattttataatgctgaggatgaatcaaatcttctcttacct
aaactacctacactgccaaaaaactatagcaacacctcaaaaatatttagtgaagaaaat
tctgatgaaattattaagctcttgggagacgtcaggcttaatattctcgtccttggagga
agctctggatttattgagctttatgcttatggaatgtttaaaattgctcgagtcacaggg
attgctggtacttgtcttgcattatgtttatcaagtgatttgaaatcattatcagtggtc
acagaagtctctaccaatggtgcttcagaagtttcatactttcagcttgaaactaatctg
ttgtactctttcttacctgaagtaactcggatggccagaaagtttactcatatttcagct
ctgttacagtatataaatttgtcactaacatgtatgtgtgaagcatgggaagaaatacta
atgcagatggattctcgtctcaccaagtttgtgcaggaaaagaacacaaccacatcagtg
caagatgagttcatgcacttgctattatgggggaaagcaagtgctgaacttcagactctc
ttgatgaatcagttaacagtaaagggcttgaaaaagcttggccagtctatagagtcatca
tactccagtatacaaaaattggtcataagtcatttacagagtggctcggagtctttatta
taccatttgagtgaattgaaaggaatggcttcatggaagcaaaaatatgaacctcttgga
ctagatgctgcaggaatcgaagaagctataactgctgtgggttcttttatactcaaggca
aatgaacttcttcaagttatagatagtagtatgaaaaacttcaaagcattttttcggtgg
ctttatgtggcaatgttgagaatgacagaagaccatgtgcttcccgagctgaataagatg
actcagaaagatatcacatttgttgctgaatttcttactgaacatttcaatgaggctcca
gacctttataatcgaaaaggaaaatactttaacgttgaaagagttggtcagtacttgaaa
gatgaagatgatgatcttgtgtcaccccctaacacagaaggaaaccagtggtatgacttt
cttcaaaatagcagccaccttaaagaaagtcctttgctgtttccttattatcctcgaaaa
tcattgcattttgtgaaaaggcggatggagaatattattgatcagtgtttgcaaaagcca
gcagatgtaattggaaaatcgatgaatcaagcaatctgtattccattgtatagagatacc
agaagtgaggattctacacgtagattgttcaaatttccttttctgtggaataataaaact
tcaaatctacattatcttctttttactattctagaagattcactttataaaatgtgcatc
ttaaggagacatactgatatttctcaatctgtgagtaatggactaattgctattaaattt
gggagctttacatatgccacaacagaaaaagtcagaagaagcatctacagttgtttagat
gcacagttttatgatgatgaaactgtaacagtagttcttaaagacactgtaggacgtgaa
ggaagagatagactcttggtccagctgcctttgtctttagtatataacagtgaagattct
gcagaatatcagttcactgggacttattctacaaggctagatgaacagtgtagtgctatt
cccacccgtaccatgcattttgagaagcactggagattactggaaagtatgaaagcacag
tatgttgctgggaatggttttcgaaaagtgtcctgtgtgttaagctcaaatcttcgtcat
gtgagagtatttgaaatggacatagatgatgaatgggagctcgatgagtcttcagatgaa
gaggaggaggccagtaataagcctgtaaaaataaaggaagaagtgttgtcggagtcagag
gcagagaaccaacaagctggtgctgccgctttagctccagagatagtcattaaagtggaa
aaacttgaccctgagctagactcctaa

DBGET integrated database retrieval system