KEGG   Homo sapiens (human): 29948
Entry
29948             CDS       T01001                                 
Symbol
OSGIN1, BDGI, OKL38
Name
(RefSeq) oxidative stress induced growth inhibitor 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Pyr_redox_3 Pyr_redox_2 Lys_Orn_oxgnase
Other DBs
NCBI-GeneID: 29948
NCBI-ProteinID: NP_892026
OMIM: 607975
HGNC: 30093
Ensembl: ENSG00000140961
Pharos: Q9UJX0(Tbio)
UniProt: Q9UJX0
Position
16:83953240..83966332
AA seq 477 aa
MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPHPLLQRKLTEA
PGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFGGNMKSVLTWKHRKEHAIPHV
VLGRNLPGGAWHSIEGSMVILSQGQWMGLPDLEVKDWMQKKRRGLRNSRATAGDIAHYYR
DYVVKKGLGHNFVSGAVVTAVEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWAR
NVVLATGTFDSPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA
VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSILSPSPYEGYRS
LPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHPDLSFLPGAGADFAVDPDQPL
SAKRNPIDVDPFTYQSTRQEGLYAMGPLAGDNFVRFVQGGALAVASSLLRKETRKPP
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgagctcctccagaaaggaccacctcggcgccagcagctcagagcccctcccggtcatc
attgtgggtaacggcccctctggtatctgcctgtcctacctgctctccggctacacaccc
tacacgaagccagatgccatccacccacaccccctgctgcagaggaagctcaccgaggcc
ccgggggtctccatcctggaccaggacctggactacctgtccgaaggcctcgaaggccga
tcccaaagccccgtggccctgctctttgatgcccttctacgcccagacacagactttggg
ggaaacatgaagtcggtcctcacctggaagcaccggaaggagcacgccatcccccacgtg
gttctgggccggaacctccccgggggagcctggcactccatcgaaggctccatggtgatc
ctgagccaaggccagtggatggggctcccggacctggaggtcaaggactggatgcagaag
aagcgaagaggtcttcgcaacagccgggccactgccggggacatcgcccactactacagg
gactacgtggtcaagaagggtctggggcataactttgtgtccggtgctgtagtcacagcc
gtggagtgggggacccccgatcccagcagctgtggggcccaggactccagccccctcttc
caggtgagcggcttcctgaccaggaaccaggcccagcagcccttctcgctgtgggcccgc
aacgtggtcctcgccacaggcacgttcgacagcccggcccggctgggcatccccggggag
gccctgcccttcatccaccatgagctgtctgccctggaggccgccacaagggtgggtgcg
gtgaccccggcctcagaccctgtcctcatcattggcgcggggctgtcagcggccgacgcg
gtcctctacgcccgccactacaacatcccggtgatccatgccttccgccgggccgtggac
gaccctggcctggtgttcaaccagctgcccaagatgctgtaccccgagtaccacaaggtg
caccagatgatgcgggagcagtccatcctgtcgcccagcccctatgagggttaccgcagc
ctccccaggcaccagctgctgtgcttcaaggaagactgccaggccgtgttccaggacctc
gagggtgtcgagaaggtgtttggggtctccctggtgctggtcctcatcggctcccacccc
gacctctccttcctgcctggggcaggggctgactttgcagtggatcctgaccagccgctg
agcgccaagaggaaccccattgacgtggaccccttcacctaccagagcacccgccaggag
ggcctgtacgccatggggccgctggccggggacaacttcgtgaggtttgtgcaggggggc
gccttggctgtggccagctccctgctaaggaaggagaccaggaagccaccctaa

DBGET integrated database retrieval system