KEGG   Homo sapiens (human): 29957
Entry
29957             CDS       T01001                                 

Gene name
SLC25A24, APC1, SCAMC-1, SCAMC1
Definition
(RefSeq) solute carrier family 25 member 24
  KO
K14684  solute carrier family 25 (mitochondrial phosphate transporter), member 23/24/25/41
Organism
hsa  Homo sapiens (human)
Disease
H02480  Fontaine progeroid syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    29957 (SLC25A24)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   29957 (SLC25A24)
SSDB
Motif
Pfam: Mito_carr EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_10 Dockerin_1 Sigma_reg_C Rota_NSP3
Other DBs
NCBI-GeneID: 29957
NCBI-ProteinID: NP_037518
OMIM: 608744
HGNC: 20662
Ensembl: ENSG00000085491
Vega: OTTHUMG00000011013
Pharos: Q6NUK1(Tbio)
UniProt: Q6NUK1
Structure
PDB: 
4ZCU 4N5X 4ZCV

Position
1p13.3
AA seq 477 aa
MLRWLRDFVLPTAACQDAEQPTRYETLFQALDRNGDGVVDIGELQEGLRNLGIPLGQDAE
EKIFTTGDVNKDGKLDFEEFMKYLKDHEKKMKLAFKSLDKNNDGKIEASEIVQSLQTLGL
TISEQQAELILQSIDVDGTMTVDWNEWRDYFLFNPVTDIEEIIRFWKHSTGIDIGDSLTI
PDEFTEDEKKSGQWWRQLLAGGIAGAVSRTSTAPLDRLKIMMQVHGSKSDKMNIFGGFRQ
MVKEGGIRSLWRGNGTNVIKIAPETAVKFWAYEQYKKLLTEEGQKIGTFERFISGSMAGA
TAQTFIYPMEVMKTRLAVGKTGQYSGIYDCAKKILKHEGLGAFYKGYVPNLLGIIPYAGI
DLAVYELLKSYWLDNFAKDSVNPGVMVLLGCGALSSTCGQLASYPLALVRTRMQAQAMLE
GSPQLNMVGLFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVYENMKQTLGVTQK
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgttgcgctggctgcgggacttcgtgctgcccaccgcggcctgccaggacgcggagcag
ccgacgcgctacgagaccctcttccaggcactggaccgcaatggggacggagtggtggac
atcggcgagctgcaggaggggctcaggaacctgggcatccctctgggccaggacgccgag
gagaaaatttttactactggagatgtcaacaaagatgggaagctggattttgaagaattt
atgaagtaccttaaagaccatgagaagaaaatgaaattggcatttaagagtttagacaaa
aataatgatggaaaaattgaggcttcagaaattgtccagtctctccagacactgggtctg
actatttctgaacaacaagcagagttgattcttcaaagcattgatgttgatgggacaatg
acagtggactggaatgaatggagagactacttcttatttaatcctgttacagacattgag
gaaattatccgtttctggaaacattctacaggaattgacataggggatagcttaactatt
ccagatgaattcacggaagacgaaaaaaaatccggacaatggtggaggcagcttttggca
ggaggcattgctggtgctgtctctcgaacaagcactgcccctttggaccgtctgaaaatc
atgatgcaggttcacggttcaaaatcagacaaaatgaacatatttggtggctttcgacag
atggtaaaagaaggaggtatccgctcgctttggaggggaaatggtacaaacgtcatcaaa
attgctcctgagacagctgttaaattctgggcatatgaacagtacaagaagttacttact
gaagaaggacaaaaaataggaacatttgagagatttatttctggttccatggctggagca
actgcacagacttttatatatccaatggaggttatgaaaaccaggctggctgtaggcaaa
actgggcagtactctggaatatatgattgtgccaagaagattttgaaacatgaaggcttg
ggagctttttacaaaggctatgttcccaatttattaggtatcataccttatgcaggcata
gatcttgctgtgtatgagctcttgaagtcctattggctggataattttgcaaaagattct
gtaaaccctggagtcatggtgttgctgggatgcggtgccttatccagcacctgtggtcag
ctggccagctacccattggctttggtgagaactcgcatgcaggctcaagccatgttagaa
ggttccccacagctgaatatggttggcctctttcgacgaattatttccaaagaaggaata
ccaggactttacagaggcatcaccccaaacttcatgaaggtgctccctgctgtaggcatc
agttatgtggtttatgaaaatatgaagcaaactttaggagtaacccagaaatga

DBGET integrated database retrieval system